KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_010320Help
Entry
SEEB0189_010320   CDS       T02739                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:seeb03009]
    SEEB0189_010320 (rrmA)
Enzymes [BR:seeb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     SEEB0189_010320 (rrmA)
Ribosome biogenesis [BR:seeb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SEEB0189_010320 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_4 MTS Ubie_methyltran Methyltransf_23 Methyltransf_32 MetW Methyltransf_2 DUF938 Methyltransf_29 PrmA AdoMet_MTase PCMT Methyltransf_8 Methyltransf_5 NodS Pox_MCEL Prok-RING_1 Methyltransf_9 CMAS
Motif
Other DBs
NCBI-ProteinID: AGQ58931
Position
2093237..2094046
Genome map
AA seq 269 aa AA seqDB search
MSFTCPLCHQPLTQINNSVICPQRHQFDVAKEGYINLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAVINLLRERLDQSATAILDIGCGEGYYTHAFAEALPGVTTFGLDVAKT
AIKAAAKRYSQVKFCVASSHRLPFADASMDAVIRIYAPCKAQELARVVKPGGWVVTATPG
PHHLMELKGLIYDEVRLHAPYTEQLDGFTLQQSTRLAYHMQLTAEAAVALLQMTPFAWRA
RPDVWEQLAASAGLSCQTDFNLHLWQRNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttacctgtccgctttgccatcagccgcttacgcagattaataacagcgttata
tgtccacagcgccatcagtttgatgtggcgaaagagggctacatcaatctgctgccggta
cagcataaacgttcgcgcgatccgggcgacagcgccgaaatgatgcaggcgaggagagcg
tttcttgatgcaggccattatcagccgctgcgcgatgccgtgattaacctgttgcgcgag
cggctggatcagtcggccacggcgattctggatatcggctgcggcgaggggtattacact
catgcttttgccgaggcgttgccgggagtcaccacgtttggactggacgttgctaaaacg
gcgatcaaagcggcggcgaagcgctattcgcaggtgaagttttgtgtggcgtcaagccat
cgactgccctttgccgatgcgtcaatggatgcggtgatcagaatctacgccccgtgtaag
gcgcaggaattggcgcgtgtggtgaaacctggtggttgggtcgttaccgccacgccaggg
ccgcatcatctgatggaactaaaagggctcatttatgatgaggtgcgtttacatgcgccg
tataccgagcagctcgacggattcacattgcagcagagtacccgccttgcttatcacatg
cagctcaccgccgaagcggctgtagcactgttgcaaatgacgccatttgcctggcgcgcc
aggccagacgtgtgggaacaactggccgccagcgccggacttagctgccagacggatttc
aaccttcatctctggcagcgtaaccgttaa

DBGET integrated database retrieval system