KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_014875Help
Entry
SEEB0189_014875   CDS       T02739                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00260  Glycine, serine and threonine metabolism
seeb01100  Metabolic pathways
seeb01110  Biosynthesis of secondary metabolites
seeb01120  Microbial metabolism in diverse environments
seeb01130  Biosynthesis of antibiotics
seeb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEEB0189_014875
Enzymes [BR:seeb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SEEB0189_014875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AGQ59666
Position
3026478..3027479
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMTAPVGDDVYGDDPTVNALQRYAADLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLENVAAKI
KADDIHFARTRLLSLENTHNGKVLPRAYLKDAWTFTRERGLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRATRWRKMVGGGMRQAGILAAAGLY
ALKHNVARLQEDHDNAAWLAQQLREAGAEVMRHETNMLFVRVGEAQAAALGDYLRERNIL
INAAPIVRLVTHLDVSREQLADVVAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgggtcgcgccatgctcgaggcgatg
atgaccgctccggtcggggacgacgtatacggcgatgaccctaccgttaacgcccttcag
cgctacgccgccgacctttccggtaaagaagcggcgctttttttacccaccggcacccag
gccaatctggtcgcgctgcttagccattgtgaacgcggcgaagagtatatcgtcggtcag
ggcgcgcataattatctctatgaagctggcggcgcggcggtgctcggcagcattcagccg
cagcccatcgacgccgccgcggacggtacgctgccgctggagaacgtggcggcgaagatt
aaagcggatgacatccacttcgcacgcacgcgcttgctcagtctggaaaatacgcataac
gggaaagtgctgccgcgcgcgtatctgaaagacgcctggacgtttacccgcgaacgtggg
ctggcgctgcacgttgacggcgcccgaatttttaacgcggtggttgcctacggctgtgag
ttaaaagagattacgcagtattgcgactcttttaccatctgcctgtcaaaaggtctcgga
acgccggtcggttcgctgctggtcggtaaccgcgactacattaaacgcgcgacgcgctgg
cgtaaaatggtcggcggcggaatgcgtcaggccgggattctggcagcggccggactgtat
gcgctgaagcataacgtggcgcgtctgcaagaggatcatgataacgccgcctggctggcg
cagcagcttcgggaagcgggcgcggaggtcatgcgccacgaaacgaatatgctgtttgtt
cgcgttggcgaagcacaggccgccgcgcttggcgactatttgcgggaacggaatatcctg
attaacgccgcgccgattgtgcgtctggtgacgcatctggatgtctctcgcgaacagctt
gccgatgtcgtcgcccactggcgcgcctttttagcccgctaa

DBGET integrated database retrieval system