KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_020540Help
Entry
SEEB0189_020540   CDS       T02739                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00230  Purine metabolism
seeb00250  Alanine, aspartate and glutamate metabolism
seeb01100  Metabolic pathways
Module
seeb_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SEEB0189_020540
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SEEB0189_020540
Enzymes [BR:seeb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SEEB0189_020540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGQ60542
Position
complement(4221772..4223070)
Genome map
AA seq 432 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKVE
AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYGA
TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP
LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR
TETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggaaagatc
gtcgatcttctgactgaacgggctaaatatgttgtacgctaccagggcggtcacaacgca
ggccatactctcgtaatcaacggtgaaaaaaccgttctccatcttattccatcaggtatt
cttcgcgagaatgtaaccagcatcatcggtaacggtgttgtgctgtctccggccgcgctg
atgaaagagatgaaagaactggaagaccgtggcatccccgttcgtgagcgtctgctgctg
tctgaagcctgtccgctgatccttgattatcacgttgcgctggataacgcgcgtgagaaa
gcgcgtggcgcgaaagcgatcggcaccaccggtcgtggaatcgggcctgcttatgaagat
aaagtggcacgtcgcggtctgcgtgttggtgaccttttcgacaaagaaaccttcgctgaa
aaactgaaagaagtgatggaatatcacaacttccagttggttaactactacaaagttgaa
gcggttgattaccagaaagttctggatgatacgatggctgttgccgacatcctgacttct
atggttgttgacgtttcggacctgctcgaccaggcgcgtcagcgtggcgatttcgtcatg
tttgaaggtgcgcagggtaccctgctggatatcgaccacggtacttatccgtacgtaact
tcttctaacaccacagcaggtggcgtggcgaccggttccggcctgggcccgcgttatgtt
gattacgttctgggtatcctcaaagcttactccactcgtgtaggtgcaggtccgttccca
accgaactgtttgatgaaaccggcgagttcctctgcaagcagggtaacgaatacggcgcc
actaccggccgtcgtcgtcgtaccggctggctggacaccgttgccgttcgtcgtgcggta
cagctgaactccctgtctggcttctgcctgaccaaactggacgtgctggatggcctgaaa
gaggtgaaactctgcgtggcttaccgtatgccggatggtcgcgaagtgactaccactccg
ctggcagctgacgactggaaaggtgtagagccgatttacgaaaccatgccgggctggtct
gaatccaccttcggcgtgaaagatcgtagcggtctgccgcaggcggcactgaactacatc
aagcgtattgaagaactgaccggcgtgccgattgatattatttctaccggccccgatcgt
actgagacgatgattctgcgcgacccgttcgacgcgtaa

DBGET integrated database retrieval system