KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_022225Help
Entry
SEEB0189_022225   CDS       T02739                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00010  Glycolysis / Gluconeogenesis
seeb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEEB0189_022225
Enzymes [BR:seeb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SEEB0189_022225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD AdoMet_dc PNK3P
Motif
Other DBs
NCBI-ProteinID: AGQ60781
Position
complement(4588040..4588639)
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGVWSDLSRVPLASLKQKFTMGETFHQHERGEITDEAFAEA
FCHEMALSLSYEQFAHGWQAVFVGLRPEVIAVMHKLREQGHRVVVLSNTNRLHTHFWPEE
YPEVRAAADHIYLSQDLGMRKPEARIYQHVLQKEGFSAADAVFFDDNADNIEGANQLGIT
SILVKDKATIPDYFAKLLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctacatctttgatttaggtaatgtgattgtcgacatcgactttaaccgcgtatta
ggtgtgtggagcgatctgagtcgagtaccgctggcttcgctgaagcaaaaatttacgatg
ggcgagacttttcaccaacatgaacgcggtgagataacggacgaagcgtttgctgaagct
ttctgtcatgaaatggcgttatcgctcagttatgaacaattcgcgcacggctggcaggcg
gtatttgtcggattacggcccgaagtgattgctgtcatgcataaactgcgcgagcagggg
catcgcgtggtggtgttatccaatactaaccgactgcatacccacttctggccggaggaa
tacccggaggtgcgcgctgccgccgaccatatctatttatcgcaggatttgggaatgcgt
aagccggaagcgcgtatttatcagcacgtcctgcagaaagaaggtttttccgctgccgat
gcggtctttttcgacgacaatgccgataatatagaaggggccaaccagttggggatcacc
agcattctggtgaaggataaagccaccatccctgactatttcgcgaagctgttatgctaa

DBGET integrated database retrieval system