KEGG   Salmonella enterica subsp. enterica serovar Cubana: CFSAN002050_17585Help
Entry
CFSAN002050_17585 CDS       T02734                                 

Definition
(GenBank) signal transduction histidine-protein kinase BaeS
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN002050_17585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:seec01001]
    CFSAN002050_17585
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:seec02022]
    CFSAN002050_17585
Enzymes [BR:seec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CFSAN002050_17585
Protein kinases [BR:seec01001]
 Histidine kinases
  OmpR family
   CFSAN002050_17585
Two-component system [BR:seec02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   CFSAN002050_17585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AGQ73692
Position
3266936..3268339
Genome map
AA seq 467 aa AA seqDB search
MKVWRPGITGKLFLAIFATCIVLLISMHWAVRVSFERGFIDYIKHGNEQRLQMLGDALGD
QYQQHGNWRFLRNNDRFVFQILRSFEHDNDRDKPGPGMPPHGWRTQFWVVDQNGRVLVGP
RGPVPHDGTRRPILVNGVEVGAIIASPVERLTRNTDINFDMQQRRASWMIVALSTLLAAL
ATFLLARGLLAPVKRLVEGTHRLAAGDFTTRVTPTSADELGKLAQDFNQLASTLEKNQQM
RRDFMADISHELRTPLAVLRGELEAIQDGVRQFTPESVTSLQAEVGTLTKLVDDLHQLSL
SDEGALAYQKTTVDLVPLLEVAGGAFRERFTSRGLTLHYALPDSMTVFGDPDRLMQLFNN
LLENSLRYTDSGGGLHISAEQRDKSLFLTFADSAPGVSDEQLQKLFDRFYRTEVSRNRAS
GGSGLGLAICVNIVHAHNGHLHAAHSPFGGVSITVELPLDRDLQREV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctggcggcccggaatcaccggcaagctgtttctggcgatcttcgccacctgc
atcgtgctgctgatcagtatgcattgggccgtgcgcgtcagttttgaacgcggatttatt
gactatatcaaacacggcaacgagcagcggctacaaatgctgggcgatgcgctgggcgac
cagtaccagcaacacggcaactggcgttttttacgcaacaacgatcgcttcgttttccag
attctgcgttcatttgagcatgacaacgaccgggataaacccggccccggtatgccgccg
cacggttggcgcacccagttctgggtcgtcgatcaaaatggccgggtgctggtcggccca
cgcggtccggtgccgcatgacggtactcgccgccccattctggtcaatggcgtcgaagtc
ggcgcgattatcgcctcgcctgtcgagcggctgacgcgcaatacggatattaattttgat
atgcagcagcggcgcgccagttggatgatcgtggcgttatcaacgttgctggccgcgctg
gcgacatttttgctggcgcgtggcctgctcgccccggtcaaacggttggtcgagggtacg
cacagactggcggcgggggattttaccacgcgcgtgaccccaaccagcgccgatgagctg
ggaaaactggcgcaggattttaaccagcttgccagcacgctggaaaaaaaccagcagatg
cgccgcgactttatggcggatatttcccacgaactgcgcacgccgctggcggtattgcgc
ggcgaactggaagccattcaggatggcgttcgccagttcacgccagaatcggttacctcg
ctacaggcggaagtcggtacgcttaccaaactggttgacgacctgcatcagctgtcgttg
tctgacgagggcgcgctggcttaccaaaaaacgaccgtcgatcttgttcccctgttggaa
gtcgctggcggcgcgttcagagagcgctttaccagccgggggctaacgctacattacgcg
ttgccggatagcatgaccgtcttcggcgacccggatcgcctgatgcaactgtttaataat
ctgctggaaaacagtttgcgctacaccgacagcggcggcggcctgcatatttccgccgaa
caacgcgacaaatcattattcctgacctttgccgattctgcaccgggcgtcagcgatgag
cagttacaaaagctttttgaccgtttttaccgcacggaagtgtcccgtaaccgcgccagc
ggcggttctggactggggctggcgatatgcgtcaatattgtacacgcgcataacggtcat
cttcacgccgctcattcgccttttggcggggttagcattacagtagagttaccgctggat
cgcgatttacagagagaagtatga

DBGET integrated database retrieval system