KEGG   Salmonella enterica subsp. enterica serovar Cubana: CFSAN002050_21320Help
Entry
CFSAN002050_21320 CDS       T02734                                 

Gene name
recD
Definition
(GenBank) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:seec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CFSAN002050_21320 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:seec03400]
    CFSAN002050_21320 (recD)
Enzymes [BR:seec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CFSAN002050_21320 (recD)
DNA repair and recombination proteins [BR:seec03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CFSAN002050_21320 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 SH3_13 UvrD-helicase DUF2075 AAA_22 AAA_28 AAA_16 UvrD_C MukB PhoH CbiA T2SSE FtsK_SpoIIIE Bcl-2 SRP54 DUF4277 TrwB_AAD_bind NTPase_1 AAA
Motif
Other DBs
NCBI-ProteinID: AGQ75691
Position
complement(4084614..4086449)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVGQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttggacaaaaactattacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacggctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggagatcgcctctacctgaatcgcatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaagttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagttgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcggcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttcctcttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctgggcgcacagcccggcagccagcgattacgccatcatgcgggcaacccg
ctacatctggacgtgctggtggtcgatgaagcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactaacagggagcgctattccggcgggg
gccggaacgcaagccgcgtctttacgcgatagcctctgtttgttacaaaagagctaccgt
ttcggcagcgattctggcatcggcaagctggcggcggcaattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatggtcgctacctgcgg
ttgctgcatgagaaagcgacgccggaggcaatccttcaggctttcaatgagtatcaactg
ctttgcgcgctgcgtgaaggcccatttggcgtgaggggactgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcacccgcactctcgctggtatgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcgggcaggggttacgcgtctggtttgtgatgccggacggcacgatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccagcgttcgccggtc
gtgacgcgggagctggtgtataccgctgttacgcgggcgcggcggcggttatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgtacggaacggcgcagcgggtta
gccaccttatttgatgaagtcagtcgtaccggataa

DBGET integrated database retrieval system