KEGG   Salmonella enterica subsp. enterica serovar Cubana: CFSAN002050_21450Help
Entry
CFSAN002050_21450 CDS       T02734                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec00071  Fatty acid degradation
seec00280  Valine, leucine and isoleucine degradation
seec00310  Lysine degradation
seec00362  Benzoate degradation
seec00380  Tryptophan metabolism
seec00620  Pyruvate metabolism
seec00630  Glyoxylate and dicarboxylate metabolism
seec00640  Propanoate metabolism
seec00650  Butanoate metabolism
seec00900  Terpenoid backbone biosynthesis
seec01100  Metabolic pathways
seec01110  Biosynthesis of secondary metabolites
seec01120  Microbial metabolism in diverse environments
seec01130  Biosynthesis of antibiotics
seec01200  Carbon metabolism
seec01212  Fatty acid metabolism
seec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFSAN002050_21450
   00630 Glyoxylate and dicarboxylate metabolism
    CFSAN002050_21450
   00640 Propanoate metabolism
    CFSAN002050_21450
   00650 Butanoate metabolism
    CFSAN002050_21450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFSAN002050_21450
   00072 Synthesis and degradation of ketone bodies
    CFSAN002050_21450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFSAN002050_21450
   00310 Lysine degradation
    CFSAN002050_21450
   00380 Tryptophan metabolism
    CFSAN002050_21450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFSAN002050_21450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFSAN002050_21450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN002050_21450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seec04147]
    CFSAN002050_21450
Enzymes [BR:seec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFSAN002050_21450
Exosome [BR:seec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFSAN002050_21450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ74304
Position
complement(4119998..4121176)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRSGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADTSAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggt
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtagcggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcaacaaaaagccagggccgcgattgataccggacgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacaccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcctattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgtaaaggcctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system