KEGG   Salmonella enterica subsp. enterica serovar Cubana: CFSAN002050_23730Help
Entry
CFSAN002050_23730 CDS       T02734                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec00620  Pyruvate metabolism
seec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFSAN002050_23730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seec02000]
    CFSAN002050_23730
Enzymes [BR:seec01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CFSAN002050_23730
Transporters [BR:seec02000]
 Other transporters
  Primary active transporters [TC:3]
   CFSAN002050_23730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AGQ74591
Position
complement(4576570..4578339)
Genome map
AA seq 589 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTKYDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPADLLKPELAELEADVRRQAQEK
GIQLAGNAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPVAKTEKPAASGIYT
VEVEGKAFVVKVSDGGDISQLTAAVPVASSAPATAPAGAGTPVTAPLAGTIWKVIATEGQ
TVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMQLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgactattgccattaccgacgtcgtcctgcgtgacgcccaccagtctctgttcgccacc
cgcctgcgccttgacgatatgctgccgattgccgctcagctcgacgacgtgggctacggc
tccctcgaatgctggggcggcgccaccttcgacgcctgcatccgcttcctcggcgaagac
ccgtggctgcgcctgcgcgagcttaaaaaggccatgcccaaaacgccattgcagatgctg
ctgcgcggtcagaacctgctcggctaccgccactacgccgatgacgtggtggagcgcttc
gttgagcgggcggtgaaaaacggcatggacgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcggtgcgcagccacggcgcccacgcccagggc
acactctcctacaccaccagcccggcgcacaccctgcagacctggctggacctgaccgaa
cagctgctggaaaccggcgtcgattccatcgcgattaaggacatgtccggcattctcacc
ccgatggccgcctttgagctggtgagcgaaatcaaaaaacgttttgaggtgcgcctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgctgaaggctatcgaggcg
ggcgttgacggcgtggacacggcaatttcgtccatgagcgccacctacggccacccggcc
accgaagcgctggtcgccacgcttgccggcacaaaatatgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaagtatcacgcctttgaa
ggccagctgaagggctacgacagccgtattctggtggcccaggtaccgggcggaatgctc
actaacctcgaaagccagctgaagcagcagaacgcggcggacaaactcgaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtgaccccgacctcg
cagattgtcggcactcaggcggtgctcaacgtgctgaccggggagcgctacaaaaccatc
gccaaagaaaccgccgggatactgaagggcgaatacggccacaccccggtgccggtcaac
gcggcactgcaggcgcgggtgctggaagggggcgctccggtgacctgccgtccggcggat
ttactcaaaccggaactggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
ggcattcagcttgcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
cccggcctcaaattcctcgaaaaccgccacaacccggcggcgtttgagccggtgccgcag
gcggaagccgcgcagccggtggcaaaaacagagaagcctgccgcttccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaggtcagcgacggcggcgatatcagccag
ctgacggcggccgttcctgttgcctcttctgctccggcgacggccccggcgggcgcaggc
accccggtcaccgcgccgctggcgggcactatctggaaggtgattgccacagaaggccag
acggtggccgaaggcgacgtgctgctgattctggaagccatgaagatggaaaccgaaatc
cgcgccgcgcaggccgggaccgtgcgcggcatcgcggtgaaagccggggatgcggtggcg
gtgggcgacaccctgatgcagcttgcgtaa

DBGET integrated database retrieval system