KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_01150Help
Entry
SEEH1578_01150    CDS       T02736                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00071  Fatty acid degradation
seeh00280  Valine, leucine and isoleucine degradation
seeh00310  Lysine degradation
seeh00362  Benzoate degradation
seeh00380  Tryptophan metabolism
seeh00620  Pyruvate metabolism
seeh00630  Glyoxylate and dicarboxylate metabolism
seeh00640  Propanoate metabolism
seeh00650  Butanoate metabolism
seeh00900  Terpenoid backbone biosynthesis
seeh01100  Metabolic pathways
seeh01110  Biosynthesis of secondary metabolites
seeh01120  Microbial metabolism in diverse environments
seeh01130  Biosynthesis of antibiotics
seeh01200  Carbon metabolism
seeh01212  Fatty acid metabolism
seeh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEEH1578_01150
   00630 Glyoxylate and dicarboxylate metabolism
    SEEH1578_01150
   00640 Propanoate metabolism
    SEEH1578_01150
   00650 Butanoate metabolism
    SEEH1578_01150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SEEH1578_01150
   00072 Synthesis and degradation of ketone bodies
    SEEH1578_01150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEEH1578_01150
   00310 Lysine degradation
    SEEH1578_01150
   00380 Tryptophan metabolism
    SEEH1578_01150
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEEH1578_01150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEEH1578_01150
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SEEH1578_01150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seeh04147]
    SEEH1578_01150
Enzymes [BR:seeh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SEEH1578_01150
Exosome [BR:seeh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SEEH1578_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ61839
Position
complement(117232..118410)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gctattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccggacgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system