KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_03725Help
Entry
SEEH1578_03725    CDS       T02736                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00561  Glycerolipid metabolism
seeh00640  Propanoate metabolism
seeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SEEH1578_03725 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SEEH1578_03725 (gldA)
Enzymes [BR:seeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SEEH1578_03725 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC
Motif
Other DBs
NCBI-ProteinID: AGQ62348
Position
complement(629499..630608)
Genome map
AA seq 369 aa AA seqDB search
MVTTAIFPSRYVQGKGALTTHLPQELAALGHKALILQDPVVHNTYRDTVATALHGVIEFD
IEVFSSECCDEEIARISARAQEIGADVIVGMGGGKTLDTAKATGASLRLPIAVVPTLAST
DAPCSSLVVIYTPEGKFKRYLMIPRNPTLVLVDSSIIAAAPVRFLVSGIGDALATWFEAE
DCRIKGAGNMTTRPGPMTAFELARFCYTTLMRYGRLAKLACEQHQVTPALEHVIEANTLL
SGLGFESGGLAAAHAIHNGLTVLPATHKYWHGEKVAFGTLAMLMLTDRAPELIEEVYQFC
EDIGLPTTLADIGLAGVSDDELLAVARASCQTGETIHNEPFTITPEAVQAALRAADAVGQ
ARKKIDLAG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttactaccgcgatctttccgtcacgatatgttcagggtaaaggagcgttgacaacg
catctcccgcaggaattggccgcactcggtcataaggcgctgattttgcaggatcctgtt
gttcacaacacctaccgggatacagttgcaacagcactgcacggggtgattgaatttgat
atcgaagtgttcagtagcgagtgctgtgatgaggaaattgctcgcatctccgcacgcgcg
caggaaattggcgccgatgtgattgttggtatggggggcgggaaaaccctggatacggca
aaagcaaccggcgccagcctgcggctgcctattgccgtggttcctactctggcctcaacg
gatgcgccgtgcagttcactggttgttatctatacgccagaagggaaattcaaacgctac
ctgatgattccacgtaacccgacgcttgtgctggtggacagcagtattattgctgccgcg
ccggtacgctttttggtttccgggataggcgatgcgctggcaacctggtttgaagcggaa
gattgccgcatcaaaggggccggcaatatgaccaccaggccaggaccgatgaccgcattt
gagctggcgcgcttttgctacaccaccttaatgcgctatggacgcctggcgaaacttgcc
tgtgaacaacatcaggttactccggcgctcgaacatgttatcgaagcgaatacgctatta
tccgggcttggttttgaaagcggtgggctggcggcggcgcacgccattcataacggtctg
acagtactgcccgccacgcacaaatactggcatggggaaaaggttgcgtttggcacgctg
gcaatgcttatgctcaccgatagagcgcctgagcttatcgaggaggtttatcaattttgt
gaagatataggcttgcccaccacgctggcggatattggtctggctggcgttagcgatgat
gaactgctggccgttgccagggcgtcttgtcaaactggggaaacgatacacaacgagccg
tttaccattacgccggaggctgtgcaggcggcattgcgggccgccgatgctgttgggcag
gcgcggaaaaagatcgatcttgcaggttaa

DBGET integrated database retrieval system