KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_04515Help
Entry
SEEH1578_04515    CDS       T02736                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00051  Fructose and mannose metabolism
seeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SEEH1578_04515
Enzymes [BR:seeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SEEH1578_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AGQ62506
Position
814060..815208
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAPLNIIAC
ENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSDEDPQAQELAALITEKGPQAALAQ
ISGLDANSDVVAEAVNAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gctgacgcggggatacaactgacgtttgcggatgtaaatcaggtcgtactcgatgccctg
aatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgagcaggtggataccgtt
tccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgacctgattgcccacgtt
gatttaatcaccactgccgtgggcccggtggtgcttgagcgtatcgctccggctatcgct
aaagggctggtaaaacgtaaggcgcagggcgtggatgccccgctgaatatcatcgcctgc
gaaaatatggtgcgcggcaccacgcagctcaaaggtcatgtgatgaacgcgctggcggat
ggcgataaagcctgggttgaacagcacgttggctttgtcgattccgccgttgaccgtatt
gtgccgccttccgcttccgccacccatgacccgctggaagtgacggtagaaaccttcagc
gagtggatcgtcgataaaacccagtttaaaggcgcattgccgaccattccggggatggag
ttaacggataacctgatggcatttgtcgaacgtaaactcttcacgctgaacacgggtcat
gctataaccgcgtacctcggcaaattagccggtcatcagaccattcgcgacgctattctc
gatgagagtattcgcgcggtggtgaaaggcgcgatggaagaaagcggcgcggtgctgatc
aaacgctacggttttgatgccgacaaacatgcggcatacattcagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgacgtcgaacgcgtaggccgtcagccgctacgcaaa
ctcagcgcgggcgaccgtctgatcaaaccgctgcttggcaccctggaatatggtctgccg
catgtgaatctggtgaaagggatcgcggcggcgatgcatttccgtagcgatgaagatccg
caggcgcaggagttggcggctctgattaccgaaaaaggcccgcaggccgcgctggcgcaa
atttccgggctggatgccaatagcgatgtggtggcggaggcggttaacgcatataacgcg
accaaatga

DBGET integrated database retrieval system