KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_04735Help
Entry
SEEH1578_04735    CDS       T02736                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00770  Pantothenate and CoA biosynthesis
seeh01100  Metabolic pathways
Module
seeh_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SEEH1578_04735
Enzymes [BR:seeh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SEEH1578_04735
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SEEH1578_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP
Motif
Other DBs
NCBI-ProteinID: AGQ62550
Position
860132..861352
Genome map
AA seq 406 aa AA seqDB search
MSLAGKKIVLGVSGGIAAYKTPELVRRLRERGADVRVAMTEAAKAFITPLSLQAVSGYPV
SDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVASGMANDLVSTICLATPAPVAV
LPAMNQQMYRAAATQHNLEVLASRGLFIWGPDSGSQACGDVGPGRMLDPLVIVDKAAAHF
AAVNDLRHLNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSL
PTPPFVKRVDVITALDMEAAVQAAVQQQHIFISCAAVADYRAETIASEKIKKQAAQGDEL
LIKMVKNPDIVAGVAALSDNRPYVVGFAAETNNVEEYARQKRIRKNLDLICANDVSLSNQ
GFNSDKNALHLFWQDGDKVLPLERKELLGQLLLDEIVTRYDEKNRR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggccggtaaaaaaattgttctcggcgttagcggcggtatcgctgcgtataaa
acgccggagctggtgcgccgtttacgtgagcgcggcgctgacgtgcgcgtggcaatgacc
gaggcggcaaaagcctttattacccccctgagcttacaggcagtgtcgggctatcccgta
tccgacagtctgcttgaccctgccgccgaagccgcgatggggcatatcgagttggggaaa
tgggccgacctggtgattcttgcccccgcgaccgccgacctgatcgcccgtgtagcatcg
ggtatggctaatgatttagtctccaccatctgcctggcgacgccagccccggtggccgtt
cttccggccatgaaccaacagatgtaccgcgctgccgccacgcaacataatctggaggtg
ctcgcctctcgcggcctgttcatttgggggccggatagcggcagtcaggcgtgcggcgac
gtaggcccaggccgaatgctggacccattagttatcgttgataaggccgccgcgcatttc
gctgccgtcaacgatctgcgacatcttaatatcatgattacggcaggcccgacgcgcgaa
ccgctcgacccggtgcgttatatttccaaccacagctcaggtaaaatgggcttcgctatt
gcggcggccgcagcgcgtcgcggcgcaaatgtcacgctggtctccggtcccgtttcgtta
ccaacgccgccttttgtaaaacgggttgatgtcataaccgcgctggacatggaagccgct
gttcaggccgccgttcaacagcagcacattttcattagctgcgccgccgtggctgactat
cgcgcagagactatcgccagtgaaaaaatcaaaaaacaggcggcgcaaggtgatgaatta
ctaataaaaatggtcaaaaacccggacattgtcgccggggtggccgcactcagtgacaat
cgaccctatgttgttgggtttgccgcggaaacgaataatgtggaagaatacgcccggcaa
aaacgtatccgtaaaaaccttgacctgatttgtgcaaatgatgtttcactttcaaatcag
ggatttaatagcgataaaaacgctttacaccttttctggcaggatggagataaagtctta
ccgcttgagcgaaaagaactcctgggccaattattactcgacgagatcgtgacccgttat
gatgaaaaaaatcgacgttaa

DBGET integrated database retrieval system