KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_08940Help
Entry
SEEH1578_08940    CDS       T02736                                 

Definition
(GenBank) bifunctional DNA-binding transcriptional repressor/NMN adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00760  Nicotinate and nicotinamide metabolism
seeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SEEH1578_08940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:seeh03000]
    SEEH1578_08940
Enzymes [BR:seeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     SEEH1578_08940
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     SEEH1578_08940
Transcription factors [BR:seeh03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SEEH1578_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 CTP_transf_like Citrate_ly_lig HTH_26 MMR_HSR1 HTH_37 ABC_tran AAA_29 FAD_syn Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AGQ63387
Position
1774320..1775552
Genome map
AA seq 410 aa AA seqDB search
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RRQKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRGLFEDSAMSQQPTV
SDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKAFMAEKGIQPSWIYTSEE
ADAPQYLEHLGIETVLVDPERTFMNISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKAFQNLLVEMLKENNIEFVHVKEADYDGRFLRCVELVKEMMGEQG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgttcgactatctcaaaaccgcgattaagcagcaaggttgcactctgcaacag
gtggctgacgccagcggtatgaccaaggggtatctgagtcagttacttaacgccaaaatc
aaaagccccagcgcgcaaaaactggaggcgctacaccgttttctcgggctggagtttccc
cgccgacagaaaaacattggcgtggtgttcggtaaattttatccattgcataccggacac
atctacttgatccagcgcgcctgtagccaggtggatgagttgcacatcattatgggatat
gacgatacgcgcgaccgcgggctgtttgaggatagcgccatgtcgcagcagcccaccgtg
tcggatcgcctgcgctggttattgcaaaccttcaaataccaaaaaaatattcgcatccac
gcctttaatgaagaggggatggagccttatccgcatggctgggacgtctggagcaacggc
attaaagcgtttatggcagagaagggaatacagccgagctggatctacacttccgaagag
gctgatgcgccgcagtatcttgagcatttagggattgagacggtgctggttgatcctgaa
cgcacgtttatgaatatcagtggggcgcaaatccgcgaaaatccgtttcgttactgggaa
tatattcctaccgaagtgaagccgtttttcgtgcgtaccgtcgccattctgggcggggaa
tcaagcggcaagtctacgctggtcaataagctcgccaatatttttaataccaccagcgcc
tgggaatatggccgcgactatgtcttttcgcatctgggcggcgatgagatggcgttacag
tattccgactacgataaaattgcgctgggtcatgcgcaatatattgattttgcagtgaaa
tatgcgaataaagtggcgtttatcgataccgatttcgtcaccacccaggcattttgcaaa
aaatacgaagggcgcgagcatccctttgtccaggcgctgatcgacgagtatcgcttcgac
ctggtgattttgctggagaataatacgccgtgggtagctgacggactgcgaagcctgggc
agttcagtggatcgcaaagcgttccagaacctgctggtcgagatgctgaaagagaacaac
attgagttcgttcacgttaaagaggctgattacgatggccgctttttgcgctgtgtggaa
ctggtgaaagagatgatgggcgagcagggataa

DBGET integrated database retrieval system