KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_06455Help
Entry
SE451236_06455    CDS       T02738                                 

Gene name
apaG
Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Brite
KEGG Orthology (KO) [BR:seen00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SE451236_06455 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-GeneID: 16386782
NCBI-ProteinID: AGQ84937
Position
complement(1390730..1391107)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaacc
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtac
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacatccccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system