KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_08910Help
Entry
SE451236_08910    CDS       T02738                                 

Definition
(GenBank) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00633  Nitrotoluene degradation
seen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SE451236_08910
Enzymes [BR:seen01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     SE451236_08910
  1.-  
   1.-.-  
    1.-.-.-  
     SE451236_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-GeneID: 16387271
NCBI-ProteinID: AGQ85343
Structure
PDB: 

Position
complement(1925457..1926110)
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEDADGRFATPEAKAANDKG
RRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGFDAEVLDAEFGLKE
KGYTSLVVVPVGHHSVEDFNAGLPKSRLPLETTLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtttctgtcgccttacagcgctactccactaaggcgttcgatcccagcaaa
aaactgaccgccgaagaagcggataaaataaaaacactactacagtacagcccctccagc
accaattcccagccgtggcactttattgtcgccagtacggaagaaggcaaagcgcgcgta
gcaaaatccgctgccggaaactacacgttcaacgaacgcaaaatgctggacgcctcccat
gtggtggtcttctgcgccaaaaccgcaatggatgacgcatggcttgagcgcgtcgtcgat
caggaagatgctgatggccgtttcgctacgccggaagctaaagcggcaaatgataaaggt
cgccgctttttcgccgatatgcaccgcgtctcgctgaaagatgaccaccagtggatggcg
aagcaggtttatctgaacgtcggcaactttctgctgggcgtcgccgcgatgggtctcgac
gccgtccccattgaaggtttcgacgccgaggtgctcgacgctgaatttggtctgaaagaa
aaaggctataccagtctggtcgtggtgccggtcggccatcatagcgtcgaggatttcaac
gccgggctgccgaaatcacgtctgccgcttgaaaccacactgacggaagtttaa

DBGET integrated database retrieval system