KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_09180Help
Entry
SE451236_09180    CDS       T02738                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Brite
KEGG Orthology (KO) [BR:seen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SE451236_09180
Enzymes [BR:seen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SE451236_09180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 16387324
NCBI-ProteinID: AGQ85386
Position
1981887..1982675
Genome map
AA seq 262 aa AA seqDB search
MFVAAGQFVVSSVWEENAQVCVSLMAQAAGRGVSLLVLPEGILARDDIDLDLPIRAAQPL
DGAFMTRLLEESAHNNMTTIFTILVPSTPGRAVNMLVALRAGHIVARYAKLHLYDAFSMQ
ESQSIDAGTVIAPVLDVEGVKVGLMTCYDLRFPDMALALALQGADVLALPTGWVRGPLKE
QQWSTLLAARALDTTSYMIAAGECGNRNIGQSRIIDPLGVTIAAAADRPALIVAEIFRER
IDQVREQLPLLQQRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgcagccgggcagtttgtggtgagttctgtatgggaagagaatgcgcaagtt
tgcgtttcgttaatggctcaggcggcgggccgcggcgtatcgcttctggtgttgcctgag
gggatattagcgcgagatgacatcgaccttgacctgccgattcgcgccgcgcagccgctg
gatggcgcgtttatgacgcggcttctggaagaaagcgctcataataatatgacgacgata
ttcactatccttgtcccgtcaacgcctggacgggcggttaatatgctggtggcgctacgg
gcgggtcacattgtcgcgcgttacgcgaagctgcatctctatgatgcgttttcgatgcaa
gaatcccaaagtattgatgccggaaccgttatcgcgcctgtgctggacgtggagggggtt
aaggtggggcttatgacctgttatgacctgcgctttccggacatggcgctagcgctggct
ttacagggggctgacgtattggcgctgccgacgggctgggttcgcggcccgttgaaagag
cagcagtggtcgacgctgctggcggcgagagcgctggataccaccagctatatgattgcg
gccggggagtgtggtaatcgtaatattggtcaaagtcgtattatcgatccgttgggggta
acgatagccgcggcagccgatcgtccggcgctgatcgtcgcggaaatattcagagaacga
atagaccaggtgcgggagcaacttcctcttttgcagcaacgacgatttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system