KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_10515Help
Entry
SE451236_10515    CDS       T02738                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00260  Glycine, serine and threonine metabolism
seen01100  Metabolic pathways
seen01110  Biosynthesis of secondary metabolites
seen01120  Microbial metabolism in diverse environments
seen01130  Biosynthesis of antibiotics
seen01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE451236_10515
Enzymes [BR:seen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SE451236_10515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 16387591
NCBI-ProteinID: AGQ85593
Position
complement(2254420..2255421)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMTAPVGDDVYGDDPTVNALQRYAADLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLENVAAKI
KADDIHFARTRLLSLENTHNGKVLPRAYLKDAWTFTRERGLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRATRWRKMVGGGMRQAGILAAAGLY
ALKHNVARLQEDHDNAAWLAQQLREAGAEVIRHETNMLFVRVGEAQAAALGDYLRERNIL
INAAPIVRLVTHLDVSREQLTDVVAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgggccgcgccatgctcgaggcgatg
atgaccgccccggtcggggacgacgtatacggcgatgaccctactgttaacgcccttcag
cgctacgccgccgacctttccggtaaagaagcggcgctttttttacccaccggcacccag
gccaatctggtcgcgctgcttagccattgtgaacgcggcgaagagtatatcgtcggtcag
ggcgcgcataattatctctatgaagctggcggcgcggcggtgctcggcagcattcagccg
cagcccattgacgccgccgcggacggtacgctgccgctggagaacgtggcggcgaagatt
aaagcggatgacatccacttcgcgcgcacgcgcttgctcagtctggaaaatacgcataac
gggaaagtgctgccgcgcgcgtatctgaaagacgcctggacatttacccgcgaacgtgga
ctggcgctgcacgttgacggcgcccgaatttttaacgcggtggttgcctacggctgtgag
ttaaaagagattacgcagtattgcgactcttttaccatctgcctgtcaaaaggtctcgga
acgccggtcggttcactgctggtcggcaaccgcgattacattaaacgcgcgacgcgctgg
cgtaaaatggtcggcggcggaatgcgtcaggccgggattctggcagcggccggactgtat
gcgctgaagcataacgtggcgcgtctgcaagaggatcatgataacgccgcctggctggcg
cagcagcttcgggaagcgggcgcggaggtcatacgccacgaaacgaatatgctgtttgtt
cgcgttggcgaagcacaggccgccgcgcttggcgactatttgcgggaacggaatatcctg
attaacgccgcgccgattgtgcgtctggtgacgcatctggatgtctctcgcgaacagctt
accgacgtcgtcgcccactggcgcgcctttttagcccgctaa

DBGET integrated database retrieval system