KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_17880Help
Entry
SE451236_17880    CDS       T02738                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00430  Taurine and hypotaurine metabolism
seen00620  Pyruvate metabolism
seen00640  Propanoate metabolism
seen00680  Methane metabolism
seen01100  Metabolic pathways
seen01120  Microbial metabolism in diverse environments
seen01200  Carbon metabolism
Module
seen_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE451236_17880
   00640 Propanoate metabolism
    SE451236_17880
  09102 Energy metabolism
   00680 Methane metabolism
    SE451236_17880
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SE451236_17880
Enzymes [BR:seen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SE451236_17880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 16389064
NCBI-ProteinID: AGQ86775
Structure
PDB: 

Position
3735018..3736220
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagttcttcactgaaatttgcaatt
attgatgcagttaatggtgatgaatacctttctggtttagccgaatgtttccatctgcca
gaagcacgcatcaaatggaaaatggacggcagtaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgcgcagttaactgcaattggtcaccgtatcgtacacggcggcgagaagtatacc
agctccgtagtcattgatgagtccgtcattcagggcatcaaagattccgcctctttcgca
ccgctgcataacccggctcacctgattggtatcgccgaagcgctgaaatctttcccgcag
ctgaaagataaaaacgttgcagtattcgacaccgccttccatcagaccatgccggaagaa
tcttacctgtatgccctgccgtacagcctgtataaagaacacggcgttcgtcgctatggc
gcacacggcaccagccacttctatgtaactcaggaagcggcaaaaatgctgaacaagccg
gtagaagaactgaacattatcacctgccacctgggcaacggcggttctgtttccgctatc
cgtaacggtaaatgcgtggatacctctatgggtctgaccccgctggaaggcctggtcatg
ggtacccgttccggcgatatcgaccctgcgattatcttccacctgcacgacactctgggc
atgagcgtggatcagatcaacaaaatgctgaccaaagagtccggtctgctgggtctgact
gaagtgaccagcgactgccgttatgttgaagacaactacgccaccaaagaagacgctaaa
cgtgcgatggacgtttactgccaccgcctggcgaaatacatcggttcttacaccgctctg
atggacggtcgtctggatgcagtcgtgttcaccggcggtatcggtgaaaacgccgcgatg
gttcgcgagctgtctctgggtaaactgggcgtgctgggctttgaagtcgaccacgaacgt
aacctggcggcccgcttcggcaaatctggtttcatcaacaaagaaggtacccgtccggcg
gtggtgatcccaaccaacgaagaactggttatcgcgcaagacgcgagccgtctgactgcc
tga

DBGET integrated database retrieval system