KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_19560Help
Entry
SE451236_19560    CDS       T02738                                 

Definition
(GenBank) 23S rRNA/tRNA pseudouridine synthase A
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Brite
KEGG Orthology (KO) [BR:seen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:seen03009]
    SE451236_19560
Enzymes [BR:seen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SE451236_19560
Ribosome biogenesis [BR:seen03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SE451236_19560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-GeneID: 16389398
NCBI-ProteinID: AGQ87042
Position
complement(4095024..4096004)
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILNQRVLVNGQLCDKPKEKVL
GGERVAIDAEIDEEIRFEAQDIPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQLREITREYEAVAIGHMT
AGGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHFRVHTRLRLRLETGRTHQIRVHM
AHITHPLVGDQVYGGRPRPPKGASEEFISTLRKFDRQALHATMLRLYHPVSGIEMEWHAP
IPQDMVDLIDAMRADFEDHKDDVDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacaactcaccgcaacggtctccgaaaaccaactcggtcaacgctta
gatcaggctttggccgaaatgttcccggattattcacgttcgcgtataaaagaatggatt
ttgaatcagcgcgtgttggtcaatggtcaactttgcgataagccaaaagaaaaagtgtta
ggtggcgagcgggtggctattgatgcggagatcgacgaagagattcgttttgaagcgcag
gatatcccgttagatattgtttatgaagatgacgatattctggttatcaacaaaccacgc
gatctggtggtacatcctggcgcgggtaacccggacggtacggtactgaacgcgttgcta
cattattatccgccgattgcggatgtcccgcgcgcgggcattgtacatcgtctggataag
gacacgacggggctgatggtggtggccaaaaccgttccggcgcaaacgcgcctggtggag
tctttgcagctgcgcgagatcacccgcgaatatgaagcggtcgcgatcggacatatgacg
gcgggaggaacggtgaatgaacccatcagtcgtcacccgaccaaacgtacccatatgtca
gtgcatcccatgggcaaaccggcggtgacccactaccgcattatggaacatttccgtgtg
cacacgcgtcttaggctgcgtctggagaccgggcgtacgcaccagatccgcgtgcatatg
gcgcatattacgcacccgttagtgggcgatcaggtctacggtggtcgtccacgtccaccg
aaaggcgcatcggaagagtttatttccactctgcgtaagtttgaccgccaggcgcttcat
gcaacgatgctgcgtctctaccatcctgtatcgggtatcgaaatggagtggcacgcgccg
attccacaagatatggtggaccttatcgatgcgatgcgcgccgattttgaagatcataaa
gatgatgtggactggttatga

DBGET integrated database retrieval system