KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_20700Help
Entry
SE451236_20700    CDS       T02738                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00130  Ubiquinone and other terpenoid-quinone biosynthesis
seen00627  Aminobenzoate degradation
seen01100  Metabolic pathways
seen01110  Biosynthesis of secondary metabolites
seen01120  Microbial metabolism in diverse environments
seen01220  Degradation of aromatic compounds
Module
seen_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SE451236_20700
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SE451236_20700
Enzymes [BR:seen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SE451236_20700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 16389626
NCBI-ProteinID: AGQ87224
Position
4318972..4319565
Genome map
AA seq 197 aa AA seqDB search
MRLIVGMTGATGAPLGVELLQALRAIPDVETHLVMSKWAKTTIELETPYTPAEVAALADY
CHSPADQAATISSGSFRTDGMIIIPCSMKTLAGVRAGYAEGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAIVPPMPAFYNLPQTVDDIIQHIVARVLDQFGLEHTRT
RRWQGLRQTANFSQENG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattgtggggatgaccggtgcgaccggcgcgccgcttggcgtcgagctactc
caggcattgcgggcgatacctgatgttgaaacgcatctggtaatgtcaaagtgggcgaaa
accactattgaactggagacgccctacacgcccgctgaggtagccgccctggcagattat
tgtcatagcccggccgatcaggcggcgaccatttcctccggctcatttcgtaccgacggc
atgattattatcccctgcagtatgaaaacactggcgggggttcgcgccggctatgccgag
gggctggtgggacgcgctgccgatgtcgtgttgaaagagggtcgcaagctggtgcttgtg
ccgcgggaaatgccgctcagcacgattcatctggaaaacatgcttgcgctttctcgtatg
ggggtggcgatagtgccgcccatgcccgcgttctacaacctgccgcaaaccgttgacgat
attatccagcacatcgtagcgcgcgttctcgaccagtttggtctggagcatacgcgcacg
cgccgctggcaaggactgcgacagacagcaaatttttcacaggagaatggataa

DBGET integrated database retrieval system