KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_21320Help
Entry
SE451236_21320    CDS       T02738                                 

Definition
(GenBank) protein-disulfide isomerase
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Brite
Enzymes [BR:seen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SE451236_21320
Chaperones and folding catalysts [BR:seen03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SE451236_21320
Secretion system [BR:seen02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SE451236_21320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N Thioredoxin_4 DSBA TraF Glutaredoxin Redoxin DUF4093
Motif
Other DBs
NCBI-GeneID: 16389750
NCBI-ProteinID: AGQ87314
Structure
PDB: 

Position
complement(4458309..4459022)
Genome map
AA seq 237 aa AA seqDB search
MKKRFMMFTLLAAVFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYV
TDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVK
PASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgttttatgatgttcactttactggcggcggtgttttcaggcgtggcccat
gcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagtacggaaatt
caggcctcgccagtggcagggatgaaaaccgtcctcactcacagcggcgtactgtacgtc
actgatgacggcaaacatattattcaagggccgatgtatgacgtgagcggcgcgcatccg
gtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaagagatgatc
gtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatcacctgcggc
tattgtcataagctacatgaagagatgaaagattataacgcgctggggatcacggtacgt
tatctggcttttccgcgccaggggctggaaagccaggcggagcaggatatgaaatctatc
tggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaagggcgtgaaa
ccggcaagctgtgacgtgaacattgctgatcattatgcgttgggcgtgcagttgggcgtt
agcggtacgccagccattgtattgagtaacggctatgtggtgcctggctatcagggaccg
aaagagatgaaagcgtttcttgatgagcatcaaaaacagaccagtggtaaataa

DBGET integrated database retrieval system