KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_03435Help
Entry
I137_03435        CDS       T02790                                 

Definition
(GenBank) signal transduction histidine-protein kinase BaeS
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I137_03435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:seep01001]
    I137_03435
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:seep02022]
    I137_03435
Enzymes [BR:seep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     I137_03435
Protein kinases [BR:seep01001]
 Histidine kinases
  OmpR family
   I137_03435
Two-component system [BR:seep02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   I137_03435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AGS62508
Position
complement(813893..815296)
Genome map
AA seq 467 aa AA seqDB search
MKVWRPGITGKLFLAIFATCIVLLISMHWAVRVSFERGFIDYIKHGNEQRLQMLGDALGD
QYQQHGNWRFLRNNDRFVFQILRSFEHDNDRDKPGPGMPPHGWRTQFWVVDQNGRVLVGP
RGPVPHDGTRRPILVNGAEVGAIIASPVERLTRNTDINFDMQQRRASWMIVALSTLLAAL
ATFLLARGLLAPVKRLVEGTHRLAAGDFTTRVTPTSADELGKLAQDFNQLASTLEKNQQM
RRDFMADISHELRTPLAVLRGELEAIQDGVRQFTPESVTSLQAEVGTLTKLVDDLHQLSL
SDEGALAYQKTTVDLVPLLEVAGGAFRERFTSRGLTLHYALPDSMTVFGDPDRLMQLFNN
LLENSLRYTDSGGGLHISAEQRDKSLFLTFADSAPGVSDEQLQKLFDRFYRTEVSRNRAS
GGSGLGLAICVNIVHAHNGHLHAAHSPFGGVSITVELPLDRDLQREV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctggcggcccggaatcaccggcaagctgtttctggcgattttcgccacctgc
atcgtgctgctgatcagtatgcattgggccgtgcgcgtcagttttgaacgcggatttatt
gactatatcaaacacggcaacgagcagcggctacaaatgctgggcgatgcgctgggcgac
cagtaccagcaacacggcaactggcgttttttacgcaacaacgatcgcttcgtttttcag
attttgcgttcatttgagcatgacaacgaccgggataaacccggccccggtatgccgccg
cacggttggcgcacccaattctgggtcgtcgatcaaaatggccgggtgctggtcggccca
cgcggtccggtgccgcatgacggtactcgccgccccattctggtcaatggcgccgaagtc
ggcgcgattatcgcctctcctgtcgagcggctgacgcgcaatacggatattaattttgat
atgcagcagcggcgcgccagttggatgatcgtggcgttatcaacgttgctggccgcgctg
gcgacgtttttgctggcgcgtggcctgctcgccccggtcaaacggttggtcgagggtacg
cacagactggcggcgggggattttaccacgcgcgtgaccccaaccagcgccgatgagctg
ggaaaactggcgcaggactttaaccagcttgccagtacgctggaaaaaaaccagcagatg
cgccgcgactttatggcggatatttcccacgaactgcgcacgccgctggcggtattgcgc
ggcgaactggaagccattcaggatggcgttcgccagttcacgccagaatcggttacctcg
ctacaggcggaagtcggtacgcttaccaaactggttgacgacctgcatcagctgtcgttg
tctgacgagggcgcgctggcttaccaaaaaacgaccgtcgatcttgttcccctgttggaa
gtcgctggcggcgcgttcagagagcgctttaccagccgggggctaacgctacattacgcg
ttgccggatagtatgaccgtcttcggcgacccggatcgcctgatgcaactgtttaataat
ctactggaaaacagtctgcgctacaccgacagcggcggcggcctgcatatttccgccgaa
caacgcgacaaatcattattcctgacctttgccgattctgcaccgggcgtcagcgatgaa
cagttacaaaagctttttgaccgtttttaccgcacggaagtgtcccgtaaccgcgccagc
ggcggctctggactggggctggcaatatgcgtcaatattgtacacgcgcataacggtcat
cttcacgccgctcattcgccttttggcggggttagcattacagtagagttaccgctggat
cgcgatttacagagagaagtatga

DBGET integrated database retrieval system