KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_12400Help
Entry
I137_12400        CDS       T02790                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00330  Arginine and proline metabolism
seep00332  Carbapenem biosynthesis
seep01100  Metabolic pathways
seep01130  Biosynthesis of antibiotics
seep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seep00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I137_12400
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I137_12400
Enzymes [BR:seep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I137_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGS63794
Position
complement(2661222..2662325)
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGISVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtcgtaaaactcggcatcagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagctacacgcc
gcgggacatcgtattgttattgttacctctggcgcgattgccgccggacgtgaacatctc
ggctacccggaactgccggcaacgatcgcctctaaacagcttctggcggcggtagggcaa
agccgcctgattcaactgtgggagcagttgttttcaatttacggtatccatatcgggcag
atgctgttgacgcgtgcggatatggaagacagagagcgctttctgaacgcccgcgatacg
ctacgtgcattactggataaccatattgtgccggttatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgataacgataacctctccgcgctggcggctatcctggca
ggcgcggataaactgctgctgctgaccgatcagcaaggattatttaccgccgatccgcgt
agcaatccgcaggcggagcttatcaaagatgtgtatggcgttgacgatgcgctgcgctct
atcgcgggagacagcgtttccgggctgggaaccggtggtatgagcactaagcttcaggcg
gcagacgtggcctgtcgcgcgggtattgatacgattattgcctcaggcagtaaaccgggc
gtgatcggcgatgtgatggaggggatttccgtcggcacccgttttcatgcgcaagcctcg
ccgctggagaaccgcaaacgttggatcttcggcgcgccgccggcaggtgaaattacggtt
gatgaaggcgcgaccgcggcaatgctggaacgtggcagttcacttctgccaaaaggcatc
aaaagcgtgacgggcaatttctcgcggggggaggtcatcagaatttgtaacctgcaaggg
cgtgatattgctcatggcgtcagccgttataacagtgatgctctgcggcggatagccggt
caccactctcaacaaatcgatgcgattctgggctatgaatatggcccggtcgctgttcat
cgtgatgacatgattactcgataa

DBGET integrated database retrieval system