KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_13905Help
Entry
I137_13905        CDS       T02790                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00130  Ubiquinone and other terpenoid-quinone biosynthesis
seep00627  Aminobenzoate degradation
seep01100  Metabolic pathways
seep01110  Biosynthesis of secondary metabolites
seep01120  Microbial metabolism in diverse environments
seep01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    I137_13905
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I137_13905
Enzymes [BR:seep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     I137_13905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGS63984
Position
2959512..2960105
Genome map
AA seq 197 aa AA seqDB search
MRLIVGMTGATGAPLGVELLQALRAIPDVETHLVMSKWAKTTIELETPYTPAEVAALADY
CHSPADQAATISSGSFRTDGMIIIPCSMKTLAGVRAGYAEGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAIVPPMPAFYNLPQTVDDIIQHIVARVLDQFGLEHTRT
RRWQGLRQAANFSQENG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattgtggggatgaccggtgcgaccggcgcgccgcttggcgtcgagctactc
caggcattgcgggcgatacctgatgttgaaacgcatctggtaatgtcaaagtgggcgaaa
accactattgaactagagacgccctacacgcccgctgaggtagccgccctggcagattat
tgtcatagcccggccgatcaggcggcgaccatttcctccggctcatttcgtaccgacggc
atgattattatcccctgcagtatgaaaacactggcgggggttcgcgccggctatgccgag
gggctggtgggacgcgctgccgatgtcgtgttgaaagagggtcgcaagctggtgcttgtg
ccgcgggaaatgccgctcagcacgattcatctggaaaacatgctagcgctttctcgtatg
ggggtggcgatagtgccgcccatgcccgccttctacaacctgccgcaaaccgttgacgat
attatccagcacatcgtagcgcgcgttctcgaccagtttggtctggagcatacgcgcacg
cgccgctggcaaggactgcgacaggcagcaaatttttcacaggagaatggataa

DBGET integrated database retrieval system