KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_14390Help
Entry
I137_14390        CDS       T02790                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00071  Fatty acid degradation
seep00280  Valine, leucine and isoleucine degradation
seep00310  Lysine degradation
seep00362  Benzoate degradation
seep00380  Tryptophan metabolism
seep00620  Pyruvate metabolism
seep00630  Glyoxylate and dicarboxylate metabolism
seep00640  Propanoate metabolism
seep00650  Butanoate metabolism
seep00900  Terpenoid backbone biosynthesis
seep01100  Metabolic pathways
seep01110  Biosynthesis of secondary metabolites
seep01120  Microbial metabolism in diverse environments
seep01130  Biosynthesis of antibiotics
seep01200  Carbon metabolism
seep01212  Fatty acid metabolism
seep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I137_14390
   00630 Glyoxylate and dicarboxylate metabolism
    I137_14390
   00640 Propanoate metabolism
    I137_14390
   00650 Butanoate metabolism
    I137_14390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I137_14390
   00072 Synthesis and degradation of ketone bodies
    I137_14390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I137_14390
   00310 Lysine degradation
    I137_14390
   00380 Tryptophan metabolism
    I137_14390
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I137_14390
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I137_14390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I137_14390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seep04147]
    I137_14390
Enzymes [BR:seep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I137_14390
Exosome [BR:seep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I137_14390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGS64061
Position
complement(3078914..3080092)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAVDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGFKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctgtcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttcaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system