KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_18490Help
Entry
I137_18490        CDS       T02790                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00540  Lipopolysaccharide biosynthesis
seep01100  Metabolic pathways
Module
seep_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    I137_18490 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:seep01005]
    I137_18490 (rfaD)
Enzymes [BR:seep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     I137_18490 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:seep01005]
 Unusual sugar
  I137_18490 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR adh_short
Motif
Other DBs
NCBI-ProteinID: AGS64683
Position
complement(3938352..3939284)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MSGEELGDIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSENFKRDFVYVGDVAAVNLWFLESGKSGIFNLGTGRA
ESFQAVADATLAYHKKSSIEYIPFPDKLKGRYQAFTQADLTNLRNAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaatatcgttaaggccctgaat
gataaaggtatcaccgatattctggtggtggataacctgaaagacggcaccaagtttgta
aacctggtggatctgaacattgctgactatatggataaggaagatttcctgatccagatt
atgtccggagaagagctcggcgatatcgaagctattttccatgaaggcgcctgctcttcc
accaccgagtgggacggcaagtatatgatggataataactatcaatactccaaagagctc
ctgcactattgtcttgaacgcgaaatcccgttcctctacgcctcttctgccgccacctat
ggcggtcgcacgtctgatttcatcgaatcgcgcgaatacgaaaaaccgcttaacgtttac
ggctattctaaattcctgtttgatgaatatgtgcgccagatcctgccagaagcgaactcg
cagattgtcggtttccgctatttcaacgtctatggaccacgtgaaggccataaaggcagc
atggcaagcgtggcatttcatctgaatacacagttaaacaacggcgaaagcccgaaactg
tttgaaggcagcgaaaacttcaagcgcgacttcgtttacgtgggcgatgtggccgccgtt
aacctgtggttcctggaaagcggcaagtccggcatctttaacctgggcacaggccgtgcg
gaatctttccaggccgtcgccgacgcgacgctggcataccataaaaaaagcagcattgaa
tacattccgttcccggataagctgaaaggtcgctatcaggcgtttacgcaggcggattta
accaatctgcgcaacgcgggctacgacaaaccctttaagaccgtcgccgaaggcgtcacg
gagtatatggcctggctgaaccgcgacgcgtaa

DBGET integrated database retrieval system