KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_21815Help
Entry
I137_21815        CDS       T02790                                 

Definition
(GenBank) transcriptional regulator
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00760  Nicotinate and nicotinamide metabolism
seep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    I137_21815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:seep03000]
    I137_21815
Enzymes [BR:seep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     I137_21815
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     I137_21815
Transcription factors [BR:seep03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    I137_21815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 CTP_transf_like Citrate_ly_lig HTH_26 MMR_HSR1 HTH_37 ABC_tran AAA_29 FAD_syn Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AGS65148
Position
4660875..4662134
Genome map
AA seq 419 aa AA seqDB search
MRFFQQEALVSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEAL
HRFLGLEFPRRQKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRGLFED
SAMSQQPTVSDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKAFMAEKGIQ
PSWIYTSEEADAPQYLEHLGIETVLVDPERTFMNISGAQIRENPFRYWEYIPTEVKPFFV
RTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGH
AQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPW
VADGLRSLGSSVDRKAFQSLLVEMLKENNIEFVHVKEADYDGRFLRCVELVKEMMGEQG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttttccagcaggaggctcttgtgtcatcgttcgactatctcaaaaccgcgatt
aagcagcaaggttgcactctgcaacaggtggctgacgccagcggtatgaccaaggggtat
ctgagtcagttacttaacgccaaaatcaaaagccccagcgcgcaaaaactggaggcgcta
caccgttttctcgggctggagtttccccgccgacagaaaaacattggcgtggtgttcggt
aaattttatccattgcataccggacacatctacttgatccagcgcgcctgtagtcaggtg
gatgagttgcatatcattatgggatatgacgatacgcgcgaccgcgggctgtttgaggat
agcgccatgtcgcagcagcccaccgtgtcggatcgcctgcgctggttgctgcaaaccttc
aaataccaaaaaaatattcgcatccacgcctttaatgaagaggggatggagccttatccg
catggctgggacgtctggagcaacggcattaaagcgtttatggcagagaagggaatacag
ccgagctggatctacacttccgaagaggctgatgcgccgcagtatcttgagcatttaggg
attgagacggtgctggtcgatcctgaacgcacgtttatgaatatcagcggggcgcaaatc
cgcgaaaatccgtttcgttactgggaatatattcctacagaagtgaagccgtttttcgtg
cgtaccgtcgcgattctgggcggggaatcaagcggcaagtctacgctggtcaataagctc
gccaatatttttaataccaccagcgcctgggaatatggccgcgactatgttttttcgcat
ctgggcggcgatgagatggcgttacagtattccgactacgataaaattgcgctgggccat
gcgcaatatattgattttgcagtgaaatatgcgaataaagtggcgtttatcgataccgat
ttcgtcaccacccaggcattttgcaaaaaatacgaagggcgcgagcatccctttgtccag
gcgctgatcgacgagtatcgcttcgacctggtgattttgctggagaataatacgccgtgg
gtagctgacggactgcgaagcctgggcagttcagtggatcgtaaagcgttccagagccta
ttggtcgagatgctgaaagagaacaacattgagttcgttcacgttaaagaggctgattac
gatggccgctttttgcgctgtgtggaactggtgaaagagatgatgggcgagcagggataa

DBGET integrated database retrieval system