KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0062Help
Entry
UMN798_0062       CDS       T01782                                 

Gene name
oadA2
Definition
(GenBank) oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00620  Pyruvate metabolism
sef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UMN798_0062 (oadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sef02000]
    UMN798_0062 (oadA2)
Enzymes [BR:sef01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     UMN798_0062 (oadA2)
Transporters [BR:sef02000]
 Other transporters
  Primary active transporters [TC:3]
   UMN798_0062 (oadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AFD57104
Position
complement(64861..66636)
Genome map
AA seq 591 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAYELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPADLLKPELAELEADVRRQAQEK
GITLAGNAIDDVLTVALFPQIGLKFLENRNNPAAFEPLPQAEAAQPVAKAEKPAASGIYT
VEVEGKAFVVKVSDGGDISQLTAAVPAASSAPVQAAAPAGAGTPVTAPLAGNIWKVIATE
GQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccattaccgacgtcgtcctgcgtgacgcccaccagtctctgttcgccacc
cgcctgcgccttgatgacatgctgccgattgccgccgcgctcgatgacgtgggctacggg
tcgctggagtgctggggcggcgccacctttgacgcctgtatccgctttctcggcgaagac
ccgtggctgcgcctgcgcgagctcaaaaaagccatgcccaaaaccccgctgcagatgctg
ctgcgcggccagaacctgctcggctaccgccactacgccgatgacgtggtggaacgcttc
gttgagcgggcagtgaaaaacggcatggacgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcagtacgcagccacggcgcgcacgcccagggc
acactctcctacaccaccagcccggcgcacaccctgcagacctggctggatttaaccgaa
cagttgttagagaccggcgttgactcgattgccatcaaggatatgtccggcattcttaca
ccgatggcggcgtatgagctggtcagcgaaatcaaaaaacgttttgaggtgcgcctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgctgaaggctatcgaggcg
ggcgtcgacggcgtggacacggcgatttcctccatgagcgccacctacggccacccggcc
accgaagcgctggtggcaacgcttgccggcacggaacacgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaagtatcacgcctttgaa
ggccagctgaagggctacgacagccgtattctggtggcccaggtaccgggcggaatgctc
accaacctcgaaagccagctgaagcagcagaacgcggcggacaaactcgaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtgaccccaacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgagcgctacaaaaccatt
gccaaagaaacggcgggcattctgaaaggcgaatacggccacaccccggtgccggtgaac
gccgcgttacaggcccgcgtgctggaagggggcgccccggtgacctgccgtccggcggat
ttactcaaaccggaactggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
gggattactctggcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctcaaattccttgagaaccgcaataacccggcggcgtttgagccactgccgcag
gcggaagccgcgcagccggtggcaaaagcagagaagcctgccgcctccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaggtcagcgacggcggcgatatcagccag
ctcactgcggctgttccggcggcctcttccgcaccggttcaggctgccgccccggcaggc
gccggcaccccggtcaccgcgccgctggcggggaatatctggaaggtgattgccaccgag
ggccagacggtggccgaaggcgacgtgctgctgattctggaagccatgaagatggaaacc
gaaatccgcgccgcgcaggccgggacggtacgcggtatcgcggtgaagtccggggacgcg
gtctccgtcggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system