KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0291
Entry
UMN798_0291       CDS       T01782                                 

Gene name
sciB
Definition
(GenBank) SPI-6 associated protein
  KO
K11895  type VI secretion system protein ImpH
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Brite
KEGG Orthology (KO) [BR:sef00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sef02044]
    UMN798_0291 (sciB)
Secretion system [BR:sef02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UMN798_0291 (sciB)
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AFD57308
Position
complement(305720..306715)
AA seq 331 aa
MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIA
QVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQF
WQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRN
PDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGALIGQAVPDMQY
KFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGA
QRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaccggcgctctcaaccaggcgcagaaaaccccctggcgttacggattcctgaacctg
atgcggcgcgtggatgcccagctctgtgatactccggcaggcagtatctggcagccacgg
atggaaaaattccgtctgggacagacgccgacgatgacctttgcgccacgggaaatcgcc
caggtcagctggcaggatggacgcctgcacctgagcctgtacagcctcggactatggggg
ccaaacggcccgttgccgctgcactataccgagctggcactgaaccgctcagagagtcgt
cacgatccgacgctggttcatttttccaatatttttcaccaccgctggctgacgcagttc
tggcaggcatggcgcagcgcccagtccgctggtggcgggctggacaaaccggaacacgac
cgttttgcgttttatatcgccagtctcagcgggcaggatctacgggaaagcgccgaaagc
ccgctgtcagatcatgttcgcctggcagcctccgcccatctggtacgcgaatcgcgcaat
cctgacgggctggccgccacgctggcgcactatttcagcgtaccttttgcggtgaaagaa
ttcgccctgcactggataacggtggcgaacgatgaaatcacccgtctgggcacgcccgcg
cagtcttcggtgctgggcaacggggcgcttatcggccaggccgtaccggatatgcagtac
aaattccggctaattatcggcccgctcacgctggaggattacctgcgttttctgcccggc
ggcaacaatctgcccgtgctgacagaactggtgcgtacgttcatcggttttgaatattgc
tgggaaattgagctgcagttgaagcctcatgccgcaccgcctgcggtgatcggcggcgcg
cagcggcttggctggacggcctgggcaggtaaagccatgcatgaccgtccggtgaccggc
atgatttttgaacctgaacacggcttaacccactga

DBGET integrated database retrieval system