KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0292Help
Entry
UMN798_0292       CDS       T01782                                 

Gene name
sciC
Definition
(GenBank) SPI-6 associated protein
  KO
K11896  type VI secretion system protein ImpG
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Brite
KEGG Orthology (KO) [BR:sef00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sef02044]
    UMN798_0292 (sciC)
Secretion system [BR:sef02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UMN798_0292 (sciC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AFD57309
Position
complement(306712..308595)
Genome map
AA seq 627 aa AA seqDB search
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSART
QLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPI
PEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFG
ELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGEPGHFDGELNVNLQHPVAH
EGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGLSAGLQKVQGNVAEIVILLN
RLPPDWLIHQTDAAQFSLFCTPVINLLPRTTTRIEVTHSVTEQHLVVDRTRPLDYEVFSV
QEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPP
RPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRS
LIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINT
FSQMTLHSMQRGHVMTWPVRTGQRGSV
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggatccacggctactggagtattacaaccgcgaactgagctacctgcgggagaccggt
gctgagttcgccaccctccatcccaaaattgccgcccgactggggatgcagggaaccgat
attgccgacccgtatgtggaacgcatgatcgaggcgttcagctttctgagcgcccgcact
cagctaaaaattgacgccgagtttccccgcttcacacagcggttactggaagtcgtcagc
cccaattacgtcacccccacgccatcgatggcagtggtaaagctgtatcccgatacgcag
gaaggcgacctggcgaaaggggtcaccgtgccgcgcgataccgcgttcgtttcccccatc
ccggaaggcgaaaataccgcctgccagtttcgcagcagccaggacgtcacgctgtggccg
ctgtccatcgaggaggtacgcctgaccgccgcgccgccggatatgcccgccctgcaccgc
tatctgccgcctaatattcatgtcgccggggcattgcgcatcaccctgcgaaccttcggg
gaactgactttcagcgagctggccggtccggcacggctgcccttttacctctgcggcgaa
gaacgcattgcgtcacacctgtttgagctgctacataccagcgccgtcgccacactggcc
ggtgaacccggtcactttgacggcgaactgaatgtgaatcttcaacacccggtggcgcac
gaagggctggagccagggcaggggctgctaccgctcgcctggaacgtgtttcacggccat
aatctgctgcatgaatttttcgcctgtccggaacggttttacttcttcaccccgaccgga
ttgtctgccgggttacaaaaggtgcagggcaatgtggcggaaattgtcatactgcttaac
cgcctgccgccggactggctgattcatcagacggacgctgcacagttcagcctgttctgt
acgccggtgatcaacctgcttcctcgcaccaccacccggattgaagtcactcacagcgtg
acggaacagcatctggtggtggatcgtacccgtccgctggattacgaggtgttttctgtt
caggaagtcgaaggcctggaagcggaaaccacacggaagatgatttttcgtccgctgtat
cacacccgtaataatgacgaaggcaaccacgggcgttatttttcactgcgtcgtgaaccg
cgccgctcgtcagaaaacgcccgccgctatggcacccgaaccccctataccggctcggaa
gtcttcctctcgctggttgatcagcatgaagcgccctacccggaaaatctgcgccatatc
accgtcacggcaatggtgactaaccgcgatctgccctgccttattccacgtaatggccgg
gatgatctgaccgtagatgcggcgattccggtggcgggcgtgggtcttatcagaccgccg
cgcccgccgcagccgccgctggctgaacgcgaaatggcctggcggctgatccggcagttg
tcgtttaattatctgccgctggccgatctggatcaccgcaccggcggccaggcgctgcgc
gatctgctgaatctgtttatcccggctcacgacagcccgcagtcgcgccaggtgcgcagc
ctgattggctgcaaaaccaccccggtgacccgccgcctgcccggctccggcctgttggtc
tatggccggggcgtcagttgcgaactgaccgtggacgaagaaggattttccggtatcagt
ccttacctgttcggtctggtgctggaacactatattgcccgccatgtttccattaatacc
ttctcgcagatgacgctgcactcgatgcaacgcgggcatgtcatgacctggccggtcaga
accgggcaacgggggagcgtatga

DBGET integrated database retrieval system