KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0304
Entry
UMN798_0304       CDS       T01782                                 

Gene name
sciN
Definition
(GenBank) lipoprotein (SPI-6 associated)
  KO
K11906  type VI secretion system protein VasD
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sef00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    UMN798_0304 (sciN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sef02044]
    UMN798_0304 (sciN)
Secretion system [BR:sef02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UMN798_0304 (sciN)
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AFD57320
Position
319250..319741
AA seq 163 aa
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFT
TADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVW
RVTYKIPEAPEKAWYSSFISGKGKVQLEAELEQSAIVITERDK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttttgcactgctcctgctttccggatgcggcagtagcgatgcgttacctgacctc
gaatcacagcgactcgacctgagcgtgaaagcctccgataaggtgaatcctgacaatcag
aagaaggccgcgcccattgagatacgtgtttatgaactgaaaaatgacgccgctttcacg
acagctgattactggtcgctccatgacaacgacaaatccgtccttaccgacgatttagtg
cgtcgcgacagctttattttgcgtcccggcgaagagaaaaaactgcgtcgcccgctgaat
gcgcagaccacggcaatcggcgtactggccggataccgtaacctggccaaatcggtctgg
cgggtaacctacaaaatcccggaagccccggaaaaagcctggtacagcagcttcatatcg
gggaaaggaaaagtgcagttggaggcggaactggaacaaagcgccattgtaattacggaa
cgggataaatga

DBGET integrated database retrieval system