KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0354Help
Entry
UMN798_0354       CDS       T01782                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00330  Arginine and proline metabolism
sef00332  Carbapenem biosynthesis
sef01100  Metabolic pathways
sef01130  Biosynthesis of antibiotics
sef01230  Biosynthesis of amino acids
Module
sef_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UMN798_0354 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    UMN798_0354 (proB)
Enzymes [BR:sef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     UMN798_0354 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFD57359
Position
365754..366893
Genome map
AA seq 379 aa AA seqDB search
MVFISYFERQRIMSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIV
TSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADM
EDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLL
TDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAG
IDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAM
LERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDA
ILGYEYGPVAVHRDDMITR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttggtctttatttcttattttgaacggcagagaatcatgagtgacagccagacgctggtc
gtaaaactcggcaccagcgtgctaacaggcggatcgcgccgcctgaaccgtgcccatatc
gtagaacttgtccgccagtgcgcgcagttacacgccgcgggacatcgtattgttattgtt
acctctggcgcgattgccgccggacgtgaacatctcggctacccggaactgccggcaaca
attgcctctaaacagcttctggcggcggtagggcaaagccgcttgattcaactgtgggag
cagttgttttcaatttacggtatccatatcgggcagatgctgttgacgcgtgcggatatg
gaagacagagagcgctttctgaacgcccgcgatacgctacgtgcattactggataaccat
attgtgccggttatcaatgaaaatgatgccgttgcgacagcggaaattaaagtgggcgac
aacgataacctctccgcgctggcggcgatcctggcaggcgcggataaactgctgctgctg
accgatcagcaaggattatttaccgccgatccgcgtagcaatccgcaggcggagcttatc
aaagatgtgtatggcgttgacgatgcgctgcgctctatcgcgggagacagcgtttccggg
ctgggaaccggtggtatgagcactaagcttcaggcggcagacgtggcctgtcgcgcgggt
attgatacgattattgcctcaggcagtaaaccgggcgtgatcggcgatgtgatggagggg
atttccgtcggcacccgttttcatgcgcaagcctcgccgctggaaaaccgcaaacgttgg
atcttcggcgcgccgccggcaggtgaaattacggttgatgaaggcgcgaccgcggcaatg
ctggaacgtggcagttcacttctgccaaaaggcatcaaaagcgtgacgggcaatttctcg
cggggggaggtcatcagaatttgtaacctgcaagggcgtgatattgctcatggcgtcagc
cgttataacagtgatgctctgcggcggatagccggtcaccactctcaacaaatcgatgcg
attctgggctatgaatatggcccggtcgctgttcatcgtgatgacatgattactcgataa

DBGET integrated database retrieval system