KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0798Help
Entry
UMN798_0798       CDS       T01782                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00020  Citrate cycle (TCA cycle)
sef00640  Propanoate metabolism
sef00660  C5-Branched dibasic acid metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
sef01130  Biosynthesis of antibiotics
sef01200  Carbon metabolism
Module
sef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sef_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UMN798_0798 (sucD)
   00640 Propanoate metabolism
    UMN798_0798 (sucD)
   00660 C5-Branched dibasic acid metabolism
    UMN798_0798 (sucD)
Enzymes [BR:sef01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     UMN798_0798 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AFD57750
Position
806474..807343
Genome map
AA seq 289 aa AA seqDB search
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREA
VEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttttaattaataaagataccaaggttatctgccagggcttcaccggtagccag
gggactttccactccgaacaggcgattgcttacggtacgcagatggtgggcggcgtaacg
ccgggcaaaggcggcaccacgcatctggggctgccggtgttcaacaccgtgcgcgaagcg
gtagaagctaccggtgcgaccgcatccgttatctacgtcccggcgccgttctgcaaagac
tccatcctggaagcgattgacgcaggcatcaaactgattatcaccatcaccgaaggtatt
ccgacgctggatatgctgaccgtgaaagtgaagctggacgaagcaggcgtgcgcatgatc
ggcccgaactgcccaggtgtgatcaccccgggcgaatgcaaaatcggcatcatgccgggt
cacattcataagccgggtaaagtgggtatcgtttcccgttccggcacgctgacctacgaa
gcggttaagcagaccaccgactacggtttcggccagtccacctgcgtgggtatcggcggc
gacccgattccgggctctaactttatcgatatcctgaaactgttccaggaagatccgcag
actgaagcgatcgtgatgatcggtgagatcggcggtagtgcagaagaagaagcggcggct
tacattaaagaccacgtgaccaagccggttgttggctatatcgcgggtgttaccgcgccg
aaaggcaagcgtatgggccacgcgggcgccatcattgccggtggtaaaggcactgcggat
gaaaaattcgcagcgctggaagccgcgggcgtgaaaaccgttcgcagcctggccgatatc
ggcgaagcgctgaaagcaattataaaataa

DBGET integrated database retrieval system