KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1816Help
Entry
UMN798_1816       CDS       T01782                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01130  Biosynthesis of antibiotics
sef01230  Biosynthesis of amino acids
Module
sef_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMN798_1816 (trpC)
Enzymes [BR:sef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     UMN798_1816 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     UMN798_1816 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AFD58644
Position
1778447..1779805
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIASIYQHYASAISVLTDEKYFQGSFDFLPVVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLKMGVLTEVSNDEERERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRAQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVI
SGAPLQYVGVFKNADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPKQVQIWKALS
VSDALPARDYHHVDKYIFDNGQGGSGQRFDWSLLQGQPLDNVLLAGGLAADNCVQAAQVG
CAGLDFNSGVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagttttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgacgatttcgatccggcgcgtattgccagtatttatcaacattac
gcctcggcgatctcggtgctcaccgacgaaaaatattttcaggggagcttcgattttctg
ccggtcgttagccaaagcgcgccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcggtt
ctggatgacgaacagtatcgccaactctccgccgtcgcgcacagtctgaaaatgggcgtg
ctcacggaggtcagtaatgacgaagaacgggagcgcgcgatagcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgactgtcatcagcgagtccgggattaacacctat
ggtcaggtacgcgaactgagccacttcgccaacggttttttaattggctccgcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgcttggcgaaaataaagtctgc
ggcctgacccgcgcccaggacgctaaagcggcctgtgacgctggcgcaatatatggcggg
ttgatttttgtgccctcatctccgcgcgcggttagcgttgagcaggcgcgagaagtgata
agcggcgcgccattgcagtatgtcggcgttttcaagaacgctgatatcgccgatgtttgc
cagaaagccgccgtcctgtcgctttctgccgtacagctacatggcagcgaagaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgaaacaggtgcaaatctggaaggcgctgagc
gttagcgatgcccttcccgcacgcgattatcaccatgtcgataaatacattttcgacaat
gggcaaggcggcagcgggcagcgcttcgactggtcactgctacaggggcaaccgctggat
aatgtgttactggcgggcgggctggcggccgataactgcgtccaggcggcgcaagtcggc
tgtgccggtctcgattttaattcaggtgtggagtcacagccgggcatcaaagatgctcgt
cttctggcctcagtttttcagacactgcgcgcatattaa

DBGET integrated database retrieval system