KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_3832Help
Entry
UMN798_3832       CDS       T01782                                 

Definition
(GenBank) putative glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00561  Glycerolipid metabolism
sef00640  Propanoate metabolism
sef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    UMN798_3832
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    UMN798_3832
Enzymes [BR:sef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     UMN798_3832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC
Motif
Other DBs
NCBI-ProteinID: AFD60391
Position
complement(3712645..3713589)
Genome map
AA seq 314 aa AA seqDB search
MIEFDIEVFSSECCDEEIARISARAQEIGADVIVGMGGGKTLDTAKATGASLRLPIAVVP
TLASTDAPCSSLVVIYTPEGKFKRYLMIPRNPTLVLVDSSIIAAAPVRFLVSGIGDALAT
WFEAEDCRIKGAGNMTTRPGPMTAFELARFCYTTLMRYGRLAKLACEQHQVTPALEHVIE
ANTLLSGLGFESGGLAAAHAIHNGLTVLPATHKYWHGEKVAFGTLAMLMLTDRAPELIEE
VYQFCEDIGLPTTLADIGLAGVSDDELLAVARASCQTGETIHNEPFTITPEAVQAALRAA
DAVGQARKKIDLAG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttgatatcgaagtgttcagtagcgagtgctgtgatgaggaaattgctcgc
atctccgcacgcgcgcaggaaattggcgccgatgtgattgttggtatggggggcgggaaa
accctggatacggcaaaagcaaccggcgccagcctgcggctgcctattgccgtggttcct
actctggcctcaacggatgcgccgtgcagttcactggttgttatctatacgccagaaggg
aaattcaaacgctacctgatgattccacgtaacccgacgcttgtgctggtggacagcagt
attattgctgccgcgccggtacgctttttggtttccgggataggcgatgcgctggcaacc
tggtttgaagcggaagattgccgcatcaaaggggccggcaatatgaccaccaggccagga
ccgatgaccgcatttgagctggcgcgcttttgctacaccaccttaatgcgctatggacgc
ctggcgaaacttgcctgtgaacaacatcaggttactccggcgctcgaacatgttatcgaa
gcgaatacgctattatccgggcttggttttgaaagcggtgggctggcggcggcgcacgcc
attcataacggtctgacagtactgcccgccacgcacaaatactggcatggggaaaaggtt
gcgtttggcacgctggcaatgcttatgctcaccgatagagcgcctgagcttatcgaggag
gtttatcaattttgtgaagatataggcttgcccaccacgctggcggatattggtctggct
ggcgttagcgatgatgaactgctggccgttgccagggcgtcttgtcaaactggggaaacg
atacacaacgagccgtttaccattacgccggaggctgtgcaggcggcattgcgggccgcc
gatgctgttgggcaggcgcggaaaaagatcgatcttgcaggttaa

DBGET integrated database retrieval system