KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4296Help
Entry
UMN798_4296       CDS       T01782                                 

Gene name
pldA
Definition
(GenBank) detergent-resistant phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00564  Glycerophospholipid metabolism
sef00565  Ether lipid metabolism
sef00590  Arachidonic acid metabolism
sef00592  alpha-Linolenic acid metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    UMN798_4296 (pldA)
   00565 Ether lipid metabolism
    UMN798_4296 (pldA)
   00590 Arachidonic acid metabolism
    UMN798_4296 (pldA)
   00591 Linoleic acid metabolism
    UMN798_4296 (pldA)
   00592 alpha-Linolenic acid metabolism
    UMN798_4296 (pldA)
Enzymes [BR:sef01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     UMN798_4296 (pldA)
    3.1.1.32  phospholipase A1
     UMN798_4296 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFD60790
Structure
PDB: 

Position
4181765..4182634
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aaccatgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggc
agtaccgatgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccag
gtgtacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system