KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4360Help
Entry
UMN798_4360       CDS       T01782                                 

Gene name
yihU
Definition
(GenBank) putative oxidoreductase
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00650  Butanoate metabolism
sef01100  Metabolic pathways
sef01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UMN798_4360 (yihU)
Enzymes [BR:sef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     UMN798_4360 (yihU)
    1.1.1.373  sulfolactaldehyde 3-reductase
     UMN798_4360 (yihU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: AFD60846
Position
complement(4253799..4254650)
Genome map
AA seq 283 aa AA seqDB search
MASNLLKQGHQLSVFDVNPDAVQRLVDKGAQPASSPAQATIGAEFVITMLPNGDLVRSVL
FGEQGVCETLSREALVIDMSTIHPLQTDNLIADMQSKGFSMMDVPVGRTSDNAITGTLLL
LAGGTAEQVERATPVLMAMGNELVNTGGPGMGIRVKLINNYMSIALNALSAEAAVLCEAL
GLSFDVALKVMSGTAAGKGHFTTTWPNKVMKGDLSPAFMIDLAHKDLGIALDVANQLHVP
MPLGAASREVYNLARAAGRGREDWSAILEQVRISAGLTANVKK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaatctgctaaagcagggccatcaactcagcgtcttcgatgttaatcccgac
gccgtacagcgtctggtagacaaaggcgcgcaacctgcaagcagcccggctcaggcaacc
atcggcgctgaatttgttatcaccatgctcccgaacggcgatctggttcgttccgttttg
tttggcgagcaaggcgtttgtgaaactctttcccgtgaagcgctggtcattgatatgtcc
actattcatccgttgcaaaccgataatctgattgccgacatgcagagcaaagggttcagc
atgatggatgtgccggtaggccggacatccgacaacgcgattaccggcacattgttgctg
ctggcaggcggtacggcggagcaagtagagcgtgctacccctgttctgatggcgatgggt
aatgagctggtcaacaccggcggcccgggaatgggtattcgcgtaaaactgatcaacaac
tacatgagtattgcgctaaatgcgctctccgccgaagccgccgtgctgtgtgaagcgctg
gggctttccttcgacgtggctttaaaagtgatgagcggcactgccgcaggcaaagggcat
ttcaccaccacctggccgaataaagtgatgaaaggagatctgtctcccgccttcatgatc
gatctggcgcacaaagatcttggcatcgcgttggatgtcgccaatcaactgcacgtaccg
atgccgctcggcgccgcctcccgtgaagtttataacctggcgcgggccgcaggccgcggt
cgggaagactggagcgccatcctggaacaggtgcgcatcagcgccgggctgaccgccaac
gtaaaaaagtaa

DBGET integrated database retrieval system