KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4406Help
Entry
UMN798_4406       CDS       T01782                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00010  Glycolysis / Gluconeogenesis
sef00030  Pentose phosphate pathway
sef00051  Fructose and mannose metabolism
sef00052  Galactose metabolism
sef00680  Methane metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
sef01130  Biosynthesis of antibiotics
sef01200  Carbon metabolism
sef01230  Biosynthesis of amino acids
sef03018  RNA degradation
Module
sef_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sef_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN798_4406 (pfkA)
   00030 Pentose phosphate pathway
    UMN798_4406 (pfkA)
   00051 Fructose and mannose metabolism
    UMN798_4406 (pfkA)
   00052 Galactose metabolism
    UMN798_4406 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    UMN798_4406 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    UMN798_4406 (pfkA)
Enzymes [BR:sef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UMN798_4406 (pfkA)
Protein phosphatases and associated proteins [BR:sef01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UMN798_4406 (pfkA)
Messenger RNA biogenesis [BR:sef03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UMN798_4406 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFD60887
Position
4292321..4293283
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttctgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctac
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgag
gatctggtggcggaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
atcaccgaacatatgtgtgatgttgacgagctggcgcactttattgaaaaagaaacgggc
cgtgaaacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system