KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4941Help
Entry
UMN798_4941       CDS       T01782                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00240  Pyrimidine metabolism
sef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    UMN798_4941 (deoA)
Enzymes [BR:sef01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     UMN798_4941 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AFD61344
Structure
PDB: 

Position
4841006..4842436
Genome map
AA seq 476 aa AA seqDB search
MALRLSGLQIQACRPDKALAAIRRCKPSTLFPQEGTVFLAQEIIRKKRDGHALSDEEIRF
FINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDK
HSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFRE
IIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVK
VGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLT
GEYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPS
DFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFT
DMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAAIILDDKAPASTPSVYRRITE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgcttatccggcctacaaatccaggcctgtaggccggataaggcgttagcc
gccatccggcgatgtaagccttctactcttttccctcaggagggtaccgtgtttctcgca
caagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaagaaattcgtttc
tttattaatggtattcgtgacaatactatctctgaagggcagattgccgccctggcgatg
accatcttcttccacgatatgaccatgccggagcgtgtttcgctgaccatggcgatgcgg
gattccggtactgtccttgactggaaaagcctgaatctcaatggcccgattgtcgataag
cattcgaccggcggcgtaggggacgtgacgtctctgatgttggggccaatggtagcggcc
tgcggcggttatgtgccgatgatctccggtcgcggcctcggacataccggcggtacgctc
gacaaactggaagcgatcccgggcttcgatatcttcccggacgacaaccgtttccgcgaa
attattcaagacgtgggtgtggcgattattgggcaaaccagctcgcttgcaccggcggac
aaacgtttttacgccacccgcgatattaccgcgacggtggactctattccgctgatcacc
ggctccatcctcgccaagaaactggccgaagggcttgatgcgctggtaatggacgtaaaa
gtcggcagcggcgcgtttatgccaacctatgaactttctgaagcccttgctgaagcgatt
gtcggcgtggcaaatggcgcgggagttcgcactacggcgttgttaaccgatatgaaccag
gtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtgcagttcctgacc
ggtgaataccgcaatccgcgcttgtttgacgtcactatggcgctatgcgtggagatgctg
atctccggccagctggcgaaagacgacgccgaagcgcgtgccaaactgcaggcggtgctg
gataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcagaaagggccaagc
gatttcgttgagaactacgataaatacttgccgaccgccatgttgagcaaagcggtatat
gctgataccgaagggtttatcagcgcaatggatacgcgtgcgctggggatggcggtcgtc
tcgatgggcggcggccgtcgtcaggcgtctgacaccattgattacagcgttggctttacc
gacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcggtgattcatgcc
aaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggcaattatccttgac
gataaagcgccagcaagcacaccttcggtctatcgtcgaattactgaatag

DBGET integrated database retrieval system