KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1030Help
Entry
SG1030            CDS       T00770                                 

Definition
(GenBank) putative membrane protein
  KO
K11911  type VI secretion system protein VasL
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Brite
KEGG Orthology (KO) [BR:seg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seg02044]
    SG1030
Secretion system [BR:seg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SG1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N BCCT
Motif
Other DBs
NCBI-ProteinID: CAR36918
UniProt: B5R7B0
Position
complement(1114918..1116549)
Genome map
AA seq 543 aa AA seqDB search
MAARRAASVSAGRGRSSGCSAPGNLPAFRRGHSACALTWTAERWCTGYIPIRKITPSPAG
CSVSSGCRIPCTEEAEMSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKL
VESLALAIFKAHGVDLHTATYYTLARTRTHGLAGFCEGVELLAAMISHDWDKFWPQDESA
RTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERALQLICDKLQQVELKRQPHVENLLY
FVQNTRKRLEPPPKSSVDIPPQTTVRTLIYAPESTQPLTAENLPPQPELPEMKVEVHHGA
VEDPEPVARATSGRTIKGFMAGVVCAAAVAAALWWWQVYPMQQQLAQVRDTAQGAAMLWL
ASPELDSYGQRLQQLPDASPLQLLEAGMQMMHTADSRWPESLQQQQATAQWNEILKTRAQ
SSPQMRGWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQ
YQDARAQGRNAEVLEKQINERLDGVLSRWLLLKNNVVPETATKAPPPPPPKIIVKSRRLT
WPI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgcgccgcgcagcatcagtttcagcgggccgtgggcgcagttcaggctgttcg
gcgccgggcaacttaccggcgttcaggaggggacattcagcgtgcgctttaacgtggacg
gcggagcgatggtgtaccgggtacataccgatacggaagataaccccttcaccggcgggc
tgttcagtcagttccggctgccggataccctgtactgaggaagctgaaatgagtcaggac
gcactcacgcacattattgttaccggccaggatccgcgcggcctgccggagttcagcgcc
ctgcgggaagagatcaacaaatcgtctcacccgtcgcagccggagctgaactggaaactg
gtggaatcgctggcgctggccatttttaaagcccatggcgtggatctgcacacggccact
tattacaccctggcgcgcacccgcacgcacggcctggccggattttgcgaaggggtggag
ctactggcggccatgataagccacgactgggacaaattctggccgcaggatgagtcagcc
cgcaccgggatgcttgactggcttaattcgcgcaccggcaatattctgcgccagcagctg
tccttctccggcgcggacctgccgttgctgtaccgcaccgaacgggcgttacagttgatt
tgcgacaaactccagcaggtggaactgaaacgccagccgcatgtggagaacctgctttat
tttgtgcagaacacacgtaagcggcttgagccgccgccgaaaagcagcgtggacattccg
ccgcagaccaccgtcagaacgttgatctacgccccggagagcacgcagcccctcacggcg
gaaaaccttccgccccagcctgagttgccggaaatgaaggtggaagtccaccacggcgcg
gtggaggatccagagcctgtcgccagggccacgtcaggccggactataaaaggctttatg
gccggtgtcgtctgcgctgcggctgtcgcagccgcactctggtggtggcaggtgtacccg
atgcaacagcaactggcgcaggtaagggacacggcgcagggcgcggcaatgctctggctg
gcctcgcctgaactggacagctacgggcagcggttacaacagcttcccgacgcctcgccg
ctgcaactgctggaggcggggatgcagatgatgcataccgcagacagccgctggccggag
agtctgcaacagcagcaggcaacagcgcagtggaatgaaatcctgaaaacccgcgcgcaa
agcagcccacaaatgcgcggctggcagcaggcgcgccagaatctgcgtgactttgctgac
ctgatgatgcagcgggaaacggagaagcagggctttaccctctcctatattaaaacggtg
acctggcaggcggaacgcctgctgaaccaggaaacgccgctggagtccctgctgacgcag
taccaagatgcccgcgctcagggacggaatgcggaggtgctggaaaaacaaattaatgaa
cggctggatggggtgttaagccgctggctgttgctgaaaaacaatgtagtgccggaaacg
gcaactaaagcccccccccccccccccccgaaaataatagttaaatcaaggagattaaca
tggccaatttaa

DBGET integrated database retrieval system