KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1041
Entry
SG1041            CDS       T00770                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Brite
KEGG Orthology (KO) [BR:seg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seg02044]
    SG1041
Secretion system [BR:seg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SG1041
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CAR36929
UniProt: B5R7C1
Position
complement(1131957..1133429)
AA seq 490 aa
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFIASLLQSTSSA
EPVNKLAVDSMIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVL
HVTKAELLEDFEFAPEITQSGFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTTPDMKLLNY
VSAVGAMAHAPFLSSVSPEFMGLKSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPYSATENPIKSFNYAEDVSHSHEHYLWGNTAWMLASNIADSFAKYRWAPN
IIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITLTMRKNSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASF
ELSLVGRLDK
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtctttacaggaagaagaacttgtttccacccgcactgaacagggaagccatgccccg
tcgttgcttgatgaaatcatggcacaaacccgtatccagcccggcgctgacggttatgat
attgcccgtcagggcgtaacggcttttattgccagcctcctgcaatccacttcatctgca
gaacccgtaaacaaactggccgtggacagcatgattgcggacatcgacgcccgtatcagc
cgtcagatggatgctattattcacgcccctcagtttcagcaactggagtcgttctggcgt
tcaatgaaagcgctggtcgatcgcgttgattttcgtgagaatattaaggtgcatgtcctc
catgtcaccaaagcggaattgctggaagatttcgagttcgcgccggagattacccagtcc
ggcttctataagcatgtttattccagcgggtttgggcagtttggcggcgaaccgattgcg
gctgtgctgggcgcatatgagttcaaaaataccacgccggatatgaagctgctgaactat
gtcagcgccgtcggcgcaatggctcacgcgccgttcctttcttccgtgtcgccggagttt
atgggcctgaaatcatggaccgagctgcccaatatcaaggatctctacgccatttttgaa
ggtccggcctacacaaaatggcgcgccctgcgtgattccgaagattcccgctacctggga
ctgaccgcgccgcgttttctgcttcgccagccctattccgcgaccgaaaacccgattaaa
agcttcaactacgccgaagatgtgagccacagccacgagcattatttgtggggcaatacc
gcctggatgctggccagtaatatagccgattcgttcgcgaaataccggtgggcgcccaat
attatcgggccgcagagcggcggcgcagtaaaagatctgccggtacatttatatgagtca
atggggcagattcaggccaagatcccgacggaggtgttgatcaccgaccgccgtgagttc
gagctggccgaagaggggttcatcaccctgaccatgcgtaaaaacagcgataatgcggcg
tttttctcggctaacagcgttcagaaacccaagcattttccgggcaaagacgccgagacc
aactacaagctgggtacgcagttgccttatctgttcattattaaccgcctcgcgcactac
attaaggtgctgcaacgcgagcagcttgggtcgtggaaagagagaagcgatctggagcgg
gagctgaatatttgggtgcgccagtatgtcgccgatcaggagaatccgcctgctgatgtc
cgcagccgtaagccgctgcgtggcgctaaagtggaggtgctggatgtggacggcgagccg
ggctggtatcaggtggcgatttccgcaaggccgcactttaaatatatgggcgcgtcgttt
gaattgtctttagtcggacggttagataagtga

DBGET integrated database retrieval system