KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1043Help
Entry
SG1043            CDS       T00770                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:seg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SG1043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seg02044]
    SG1043
Secretion system [BR:seg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SG1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DCAF15_WD40 SBBP
Motif
Other DBs
NCBI-ProteinID: CAR36931
UniProt: B5R7C3
Position
1134853..1135371
Genome map
AA seq 172 aa AA seqDB search
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPS
GQRSHKPFIFTVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaccgtgttacatctcaattacggggcaaacccagggcaatatcaccgctggt
gcattcaccgcagattctgtcggcaatatctacgtgcagggtcacgaggatgaaatgctg
gtacaggaattcctgcataacgtgaccgtacccactgatccacagtccgggcagccgagc
ggccagcgttcgcacaagccgttcatttttaccgtggcgctgaacaaagccgtaccgctg
ctgtacaacgcgctggcgtccggtgaaatgctgccgaaaaccgaactgcactggtggcgt
acttccgttgaaggcaagcaggagcattacttcaccacccgcctgacggactcaacgatt
gtggatatgaaactgcatatgccgcactgtcaggacccggcaaagcgcgaattcacgcag
ttgctcgaagtctcgctggcctaccgcaaaatcgagtgggaacacgtcaaatccggcacc
tctggcgcggatgactggcgcgcgccgctggaagcgtaa

DBGET integrated database retrieval system