KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG2928Help
Entry
SG2928            CDS       T00770                                 

Gene name
yqeF
Definition
(GenBank) probable acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00071  Fatty acid degradation
seg00280  Valine, leucine and isoleucine degradation
seg00310  Lysine degradation
seg00362  Benzoate degradation
seg00380  Tryptophan metabolism
seg00620  Pyruvate metabolism
seg00630  Glyoxylate and dicarboxylate metabolism
seg00640  Propanoate metabolism
seg00650  Butanoate metabolism
seg00900  Terpenoid backbone biosynthesis
seg01100  Metabolic pathways
seg01110  Biosynthesis of secondary metabolites
seg01120  Microbial metabolism in diverse environments
seg01130  Biosynthesis of antibiotics
seg01200  Carbon metabolism
seg01212  Fatty acid metabolism
seg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SG2928 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SG2928 (yqeF)
   00640 Propanoate metabolism
    SG2928 (yqeF)
   00650 Butanoate metabolism
    SG2928 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SG2928 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SG2928 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SG2928 (yqeF)
   00310 Lysine degradation
    SG2928 (yqeF)
   00380 Tryptophan metabolism
    SG2928 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SG2928 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SG2928 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SG2928 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seg04147]
    SG2928 (yqeF)
Enzymes [BR:seg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SG2928 (yqeF)
Exosome [BR:seg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SG2928 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAR38733
UniProt: B5RDZ5
Position
complement(3058754..3059932)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system