KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3025
Entry
SG3025            CDS       T00770                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:seg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SG3025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seg02044]
    SG3025
Secretion system [BR:seg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SG3025
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAR38829
UniProt: B5RE90
Position
complement(3156314..3156799)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIEWQITAEKSDGAQQESRTSVWDLAMDQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgcgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcgaatggcaaatcactgccgagaaatca
gacggcgctcagcaggagtccagaacgtcagtatgggatctggcgatggaccagataggg
aaatga

DBGET integrated database retrieval system