KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3721Help
Entry
SG3721            CDS       T00770                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-Glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00540  Lipopolysaccharide biosynthesis
seg01100  Metabolic pathways
Module
seg_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:seg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SG3721 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:seg01005]
    SG3721 (rfaD)
Enzymes [BR:seg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     SG3721 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:seg01005]
 Unusual sugar
  SG3721 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR adh_short
Motif
Other DBs
NCBI-ProteinID: CAR39501
UniProt: B5RGG8
Position
complement(3911486..3912418)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MSGEELGDIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSENFKRDFVYVGDVAAVNLWFLESGKSGIFNLGTGRA
ESFQAVADATLAYHKKSSIEYIPFPDKLKGRYQAFTQADLTNLRNAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaatatcgttaaggccctgaat
gataaaggtatcaccgatattctggtggtggataacctgaaagacggcaccaagtttgta
aacctggtggatctgaacattgctgactatatggataaggaagatttcctgatccagatt
atgtccggagaagagctcggcgatatcgaagctattttccatgaaggcgcctgctcttcc
accaccgagtgggacggcaagtatatgatggataataactatcaatactccaaagagctc
ctgcactattgtcttgaacgcgaaatcccgttcctctacgcctcttctgccgccacctat
ggcggtcgcacgtctgatttcatcgaatcgcgcgaatacgaaaaaccgcttaacgtttac
ggctattctaaattcctgtttgatgaatatgtgcgccagatcctgccagaagcgaactcg
cagattgtcggtttccgctatttcaacgtctatggaccacgtgaaggccataaaggcagc
atggcaagcgtggcatttcatctgaatacacagttaaacaacggcgaaagcccgaaactg
tttgaaggcagcgaaaacttcaagcgcgacttcgtttacgtgggcgatgtggccgccgtt
aacctgtggttcctggaaagcggcaagtccggcatctttaacctgggcacaggccgtgcg
gaatctttccaggccgtcgccgacgcgacgctggcataccataaaaaaagcagcattgaa
tacattccgttcccggataagctgaaaggtcgctatcaggcgtttacgcaggcggattta
accaatctgcgcaacgcgggctacgacaaaccctttaagaccgtcgccgaaggcgtcacg
gagtatatggcctggctgaaccgcgacgcgtaa

DBGET integrated database retrieval system