KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_0059Help
Entry
SPUCDC_0059       CDS       T02824                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega00620  Pyruvate metabolism
sega01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPUCDC_0059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sega02000]
    SPUCDC_0059
Enzymes [BR:sega01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SPUCDC_0059
Transporters [BR:sega02000]
 Other transporters
  Primary active transporters [TC:3]
   SPUCDC_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AGU63014
Position
complement(64857..66626)
Genome map
AA seq 589 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRYDVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPADLLKPELAELEADVRRQAQEK
GITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPVPQAEAAQPAAAPAKAAASGIYT
VEVEGKAFVVKVSDGGDISQLTAAAPAASSAPATAPAGAGTPVTAPLAGNIWKVIATEGQ
TVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccattaccgacgtcgtcctgcgtgacgcccaccagtctctgttcgccacc
cgcctgcgccttgatgacatgctgccgattgccgccgcgctcgatgacgtgggctacggg
tcgctggagtgctggggcggcgccacctttgacgcctgtatccgctttctcggcgaagac
ccgtggctgcgcctgcgcgaactgaaaaaagccatgcccaaaaccccactgcagatgctg
ctgcgcggccagaacctgctcggttatcgccattacgccgatgacgtggtggaacgcttc
gtcgaacgcgcggtgaaaaacggcatggacgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcggtgcgcagccacggggcgcacgcccagggc
acgctctcctacaccaccagtccggcgcacaccctgcagacctggctggatttaacagag
caactgctggaaaccggcgttgactcgattgccatcaaggatatgtccggcattctcacc
ccgatggccgcttttgagctggtgagcgaaatcaaaaaacgctacgacgtacgtctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgctgaaggctatcgaggcg
ggtgttgacggcgtggacacggcgatttcgtccatgagcgccacctacggccacccggcc
accgaagcgctggtggcgacgttggcaggtactgagcacgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaagtatcacgcctttgaa
ggccagctgaagggctacgacagccgtattctggtggcccaggtaccgggcggaatgctc
accaacctcgaaagccagctgaagcagcagaacgcggcggacaaactcgaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaatgtcctgaccggcgagcgctacaaaaccatt
gccaaagaaacggcgggcattctgaaaggcgaatacggccacaccccggtgccggtgaac
gccgcgttacaggcccgcgtgctggaaggaggcgctccggtgacctgccgcccggcagac
ctgctgaagccggaactggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
gggattactctggcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctcaaattcctcgaaaaccgccacaacccggcggcgtttgagccggtaccgcag
gcggaagccgcgcagcctgccgctgccccggcaaaagccgcagcttccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaagtcagcgacggcggcgatatcagccag
ctcactgcggctgcacctgctgcctcttctgctcctgccaccgccccggcaggcgccggc
accccggtcaccgcgccgctggcggggaatatctggaaggtgattgccaccgagggccag
acggtggccgaaggcgacgtgctgctgattctggaagccatgaaaatggaaaccgaaatc
cgcgccgcgcaggccggaaccgtgcgcggcatcgcagtgaagtccggggacgccgtctcc
gtgggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system