KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1890Help
Entry
SPUCDC_1890       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AGU64732
Position
1883527..1883739
Genome map
AA seq 70 aa AA seqDB search
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQ
MKPHWRKVFH
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgcgggaagagacctccagaaccgatgacgcaataacgcaggcagtgatccgg
ttatttatcagtcagacaggcgacatcaacacagaaacactggaggtattggtcgcggcg
cttgaccagaggatcggatgtctgatggatgaaatcatccatatcaacgggtaccagcag
atgaagccacactggcgaaaggtgttccactga

DBGET integrated database retrieval system