KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1891Help
Entry
SPUCDC_1891       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
KEGG Orthology (KO) [BR:sega00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sega02044]
    SPUCDC_1891
Secretion system [BR:sega02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUCDC_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AGU64733
Position
1883788..1885260
Genome map
AA seq 490 aa AA seqDB search
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFIASLLQSTSPA
EPVNKLAVDSMIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVL
HVTKAELLEDFEFAPEITQSGFYKHVYSSGLGQFGGEPIAAVLGAYEFKNTTPDMKLLNY
VSAVGAMAHAPFLSSVSPEFMGLKSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPYSATENPIKSFNYAEDVSHSHEHYLWGNTAWMLASNIADSFAKYRWAPN
IIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITLTMRKNSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASF
ELSLVGRLDK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacaggaagaagaacttgtttccacccgcactgaacagggaagccatgccccg
tcgttgcttgatgaaatcatggcacaaacccgtatccagcccggcgctgacggttatgat
attgcccgtcagggcgtaacggcttttattgccagcctcctgcaatccacttcacctgca
gaacccgtaaacaaactggccgtggacagcatgattgcggacatcgacgcccgtatcagc
cgtcagatggatgctattattcacgcccctcagtttcagcaactggagtcgttctggcgt
tcaatgaaagcgctggtcgatcgcgttgattttcgtgagaatattaaggtgcatgtcctc
catgtcaccaaagcggaattgctggaagatttcgagttcgcgccggagattacccagtcc
ggcttctataagcatgtttattccagcgggcttgggcagtttggcggcgaaccgattgcg
gctgtgctgggcgcatatgagttcaaaaataccacgccggatatgaagctgctgaactat
gtcagcgccgtcggcgcaatggctcacgcgccgttcctttcttccgtgtcgccggagttt
atgggcctgaaatcatggaccgagctgcccaatatcaaggatctctacgccatttttgaa
ggtccggcctacacaaaatggcgcgccctgcgtgattccgaagattcccgctacctggga
ctgaccgcgccgcgttttctgcttcgccagccctattccgcgaccgaaaacccgattaaa
agcttcaactacgccgaagatgtgagccacagccacgagcattatttgtggggcaatacc
gcctggatgctggccagtaatatagccgattcgttcgcgaaataccggtgggcgcccaat
attatcgggccgcagagcggcggcgcagtaaaagatctgccggtacatttatatgagtca
atggggcagattcaggccaagatcccgacggaggtgttgatcaccgaccgccgtgagttc
gagctggccgaagaggggttcatcaccctgaccatgcgtaaaaacagcgataatgcggcg
tttttctcggctaacagcgttcagaaacccaagcattttccgggcaaagacgccgagacc
aactacaagctgggtacgcagttgccttatctgttcattattaaccgcctcgcgcactac
attaaggtgctgcaacgcgagcagcttgggtcgtggaaagagagaagcgatctggagcgg
gagctgaatatttgggtgcgccagtatgtcgccgatcaggagaatccgcctgctgatgtc
cgcagccgtaagccgctgcgtggcgctaaagtggaggtgctggatgtggacggcgagccg
ggctggtatcaggtggcgatttccgcaaggccgcactttaaatatatgggcgcgtcgttt
gaattgtctttagtcggacggttagataagtga

DBGET integrated database retrieval system