KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1893
Entry
SPUCDC_1893       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
KEGG Orthology (KO) [BR:sega00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sega02044]
    SPUCDC_1893
Secretion system [BR:sega02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUCDC_1893
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AGU64735
Position
1885678..1887531
AA seq 617 aa
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKI
EDEFPELTHGLIRMLWPNYLRPVPSMTLIEYTPDMDKTSVPVLIPRNEQFTTGAKGTQGN
PVLSAYSGNEHDVAPPCTFTLCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFAT
LDLNRLRFWLGNDDNYTRYQLYLWFCEYLQGAELMAGGQSIPMPEFMLKAVGFESEDAML
PWPGNVHSGYRILQEFFCYADSFLFFDACGIPALPDRLKENRFTLRLRFSRPLPADIRLR
DDSLRLYCAPAINLFSHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNSVVSQTQGKQR
KADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPV
IDGSLHWSLLSAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETT
PVDRLFTGIPVRGLASTLSIHTEPFVCEGEMYLLGAVLSHFLSLYAIVNSFHMLTVVNTE
SQESWKWAERTGQHPLI
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggaattcgaagaacgctattacaggcaggagttggatcacctgcggcagttgagcaag
ctgctggcgaccgaaaagccgcatctggcccggtttctggcagaaaaagaggccgatccg
gatatcgagcgtctgctggagggcgtggcctttctgaccggcaatctgcgccagaaaatc
gaggatgagtttccggagctgacgcacggactgatccggatgctgtggcccaattatctg
cgcccggtgccgtcgatgacgctgattgaatatacgccggatatggataaaacttccgtg
ccggtactgatcccccgtaatgagcagttcacaaccggggcgaaggggactcagggaaac
ccggtattgtctgcgtattccggcaatgagcacgatgtagccccgccctgtacgttcacc
ctgtgccgggatatctggctgttacccgttcaactggatcaggttgaaaatcgcagtacg
ccccgccacggcattattgatattacgtttgccgtcgcaccgggcactgattttgccacg
ctggatctgaacaggctgcgcttctggctgggcaacgatgataactatacccgctatcag
ctttatctgtggttttgtgaatatttacagggcgcagagttgatggcgggcgggcagtcg
atcccgatgcctgaatttatgctgaaagcggtgggttttgagtcagaggacgccatgctg
ccctggcccggcaatgtccacagcggctaccgcattctccaggagtttttctgctacgcc
gacagttttctgtttttcgatgcctgtggcattccggcattgccagacaggttaaaggag
aaccgtttcactctgcggctgcggttttctcgccccttaccggcagatatccggctgcgg
gatgattccctgcgcttatattgtgcgcccgccattaatctgttttcccaccatgccgaa
gccatcacgctggatcatcagcggcaggattacgctctggttcccagccgtcattttccg
gatcattacgacattttttcggttaacagcgtggtgagtcagacgcaggggaagcagaga
aaagcggatcttggacggccggtgatcacagaggccgcgcgccactggcctgcttttgag
agtttccgccaccagatggagtacagccgtaagcgggaagtggtctactggcagcaccgg
accaggacctcgctgtttcaccggggctttgatcataccctggcttttattcatgccgat
ggcagcctcccggatgcctcactgcttaataatgaagtggtttctgtatcgctgacctgc
accaaccgggagctgccggtacagctacggcccggcgatatcaccggtacgacaggtaaa
aacgcgtcggtggcgtcatttcgcaatatcacccgccccaccagaccgctctggccggtg
attgacggcagcctgcactggtcgttgctgtctgccatgaacctgaattatctgtcgttg
ctggatgctgatgcgctcaaacaggtgatcgccaattttgatcgccacgccatccatcat
ccgcagatggcccgtctgtcacagcagaagctggacgccattgaacggctggaaacaacc
ccggttgatcgcctgtttaccggcataccggtgcgcgggctggcgtccaccctgtccatt
catacggagccgtttgtctgcgagggtgaaatgtacctgctgggcgcggtgctgtcgcat
tttctgtcgctgtacgccatcgtcaattcgttccacatgctgaccgtcgttaacacggaa
agccaggagtcatggaaatgggcggaaagaaccgggcaacacccgctcatctga

DBGET integrated database retrieval system