KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1894
Entry
SPUCDC_1894       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
KEGG Orthology (KO) [BR:sega00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sega02044]
    SPUCDC_1894
Secretion system [BR:sega02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUCDC_1894
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AGU64736
Position
1887495..1888583
AA seq 362 aa
MGGKNRATPAHLSPDDAPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLS
LDTPPAQETIRFQADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHL
AWKSAHEQSPVSDFLDMFSHRLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHR
QLRDSLPVNHSKMLAYAGILANPGRSPEIVCTLVAHCFDLNLSDVTLQNWQRRMVDIEPD
QQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSINHLSRKQFLSFLPSGENF
LPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEPGEHPSVTIRV
RE
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgggcggaaagaaccgggcaacacccgctcatctgagtccggacgatgctccggcgcag
gatgaacaacgcacgctgcgggagccgttgtttcaggacgcctgcgcctgcaattttttc
gcgctctctgagctgctgcaccggctggcatcagaaggcggcgaaacgccagtgttatcc
ctggatacccctccggcgcaggaaaccattcgtttccaggcggacgccagcctgggattt
ccggtaagcgatgtcagcgcgctggagcaggatgcttccgggttgttccggatgaccacc
acctttatgggattgcagggcagccagtcgcccctccccggctattaccttgatcacctg
gcctggaaatccgcgcacgagcagagtccggtcagcgattttctggatatgttcagccat
cgcctgacgcagtttgtctggcatatctggcgtaagtaccgttaccacgtcgctttccgt
aacggcggcgtggatgcgttctcgcagcggatgtactccctggtggggctgggccaccgg
cagcttcgcgacagtctgcccgttaaccacagcaaaatgctggcctatgccgggatactg
gcaaatccgggacgttcgccggagatcgtctgtacgctggttgcgcactgtttcgattta
aatttatcggacgtgacgctgcaaaactggcagcggcggatggtggatatcgagccggat
cagcagaacagtcttggatgttacacgattaaaaatggcgaaaaactggccgggcgatcg
gtgctgggtaattttgtcctcggtacgcgggttcccgatctcagcggtaaatttcagtta
agtattaaccacctgagccgcaagcagtttctctcgttcctgccgtcaggagaaaatttt
ctgccgctggcgatgtttgtctccttcgtcctgcgcgatcagcttgcctgggatttacac
ctggggctggccccggatcaggtggggattatgcggctgggcgataacaagagcgcgctg
ctgggctggacgtcatttctcggcgagccgggagagcatccctcagtcaccatcagggtc
agggagtaa

DBGET integrated database retrieval system